Beschreibung
Daily with Joanne Colan
Podcast abonnieren
|
|
In einem Programm
|
|
Manuell
Kopiere die RSS Feed Adresse in deinen Podcatcher:
|
Joanne replaces her face with album covers.
Click here for show credits.
Twitter: http://twitter.com/rocketboom
Facebook: http://facebook.com/rocketboom
Datum: 20.10.2011 11:21 •
Größe: 0.3 KB
Joanne discusses fallacies.
click here for show credits.
twitter: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 10.10.2011 21:12 •
Größe: 35.4 MB
Joanne explains chaos theory. Originally aired on July 1, 2008
Click here for show credits.
Twitter: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 26.09.2011 17:17 •
Größe: 35 MB
Joanne travels backwards through NYC. Originally aired March 18, 2008.
Click here for show credits.
Twitter: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 23.09.2011 16:22 •
Größe: 15.1 MB
Joanne goes through the longest words in the English Language. Originally aired February 6, 2009
Click here for Show Credits
Twitter: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 21.09.2011 18:38 •
Größe: 26.1 MB
Beep beep why do stars twinkle from space? Amanda answers in this musical episode.
Originally aired September 27th, 2005.
Click here for show credits: http://bit.ly/mSAkwK
Twitter: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 19.09.2011 19:56 •
Größe: 25.7 MB
Here we go kids! First of our archive episodes! Remember when Karl Rove and Dick Cheney leaked a CIA official’s name? Neither does Amanda, because she drank too much, during the press conference. Originally published July 15, 2005.
Show Credits: http://bit.ly/pH1kdi
Twitter: @rocketboom
Face...
Datum: 14.09.2011 18:33 •
Größe: 27.8 MB
ZOMG! We just announced something!!! Stay tuned, Rocketboomers!!!
Click here for Show Credits: http://bit.ly/mVq1qc
Twitter
Facebook
Datum: 12.09.2011 17:59 •
Größe: 0.3 KB
Advice Animals Week on Rocketboom concludes with The ABCs of Advice Animals. Catch ‘em all!
Click here for show credits.
Tweets: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 25.08.2011 21:51 •
Größe: 11.9 MB
Need some help? Never fear, because Rocketboom has come with a supply of Advice Animals!
Click here for Show Credits.
Twitters: @rocketboom
Faces: facebook.com/rocketboom
Datum: 22.08.2011 19:36 •
Größe: 17.5 MB
The nose knows. In today’s episode, Rocketboom details the olfactory prowess of other species. Click here for show credits. Like us on Facebook! Follow us on Twitter!
Datum: 16.08.2011 16:47 •
Größe: 15.1 MB
2,3,5,7,11,13. Prime numbers, kids. We’re breaking it all down for you.
Click here for show credits: http://bit.ly/pglbXG
Twitter: http://www.twitter.com/rocketboom
Facebook: http://www.facebook.com/rocketboom
Datum: 08.08.2011 21:51 •
Größe: 25.7 MB
You know how you have that copy of that one game from your friend and he burned it but you can’t figure out how to get past that one #$%@$%^ level? Rocketboom can tell you why.
Click here for Show Credits: http://bit.ly/ouTJEM
Twitter: http://twitter.com/rocketboom
Facebook: http://faceboo...
Datum: 02.08.2011 18:57 •
Größe: 25.7 MB
Wonder how the universe will end? WONDER NO MORE!!! We have the exclusive scoop.
Click here for show credits: http://bit.ly/r7FLho
Tweets: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 29.07.2011 13:35 •
Größe: 24.7 MB
Today on Rocketboom, we discuss the topic of gay marriage in America.
Click here for episode details.
twitter: @rocketboom
facebook: facebook.com/rocketboom
Datum: 25.07.2011 18:09 •
Größe: 22.3 MB
Today, Molly takes you on an adventure through the electromagnetic spectrum!
Click here for show credits.
twitter: @rocketboom
facebook: facebook.com/rocketboom
Datum: 21.07.2011 20:03 •
Größe: 28 MB
Molly goes through the options we have as voters wanting to cast our votes for the Republicans.
Click here for Show Credits.
Tweets: @rocketboom
Facebook: Facebook.com/rocketboom
Datum: 18.07.2011 22:36 •
Größe: 34.9 MB
It all ends this weekend. Rocketboom takes a look at the phenomenon of the Harry Potter universe.
Click here for show credits.
Tweetilydeets: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 14.07.2011 20:16 •
Größe: 39.3 MB
Rocketboom explains Googles newest entry into the social networking sphere: Google Plus (G+)
Click here for Show Credits: http://bit.ly/o4rJM7
Tweets: @rocketboom
Face: facebook.com/rocketboom
Datum: 12.07.2011 00:27 •
Größe: 36.2 MB
Specie Invaders!!! Today, Rocketboom points out a couple invasive species you should be on the lookout for. Destroy them before they destroy you!
Click here for show credits.
Tweets: @rocketboom
Facebooks: facebook.com/rocketboom
Datum: 07.07.2011 20:26 •
Größe: 108.1 MB
Nothing lasts forever, but the animals on today’s episode stick around a lot longer than the rest of us. Molly included. Show credits here. Follow us on Twitter! Friend us on Facebook!
Datum: 05.07.2011 21:09 •
Größe: 0.3 KB
In today’s episode, Molly reveals your password to the world.
click here for Show Credits.
Twitter: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 01.07.2011 19:40 •
Größe: 22.2 MB
What are bitcoins? Molly explains in today’s episode.
Click here for show notes.
Tweets: @rocketboom
Facebookery: facebook.com/rocketboom
Datum: 29.06.2011 17:43 •
Größe: 31.3 MB
Humanwire correspondent Ruud Elmendorp goes to Nairobi to profile a group of women who have become auto mechanics there.
Click here for show credits.
Follow us on Twittah: @rocketboom
Like us on Facebook: facebook.com/rocketboom
Seeing ads? Visit Rocketboom.com for an ad-free experience.
Datum: 27.06.2011 21:57 •
Größe: 42.7 MB
Molly tackles the moneymaking schemes targeting kids online…that are then used on adults.
Click here for show credits.
Follow us on Twitter: @rocketboom
Friend us on bookface: facebook.com/rocketboom
Datum: 24.06.2011 19:28 •
Größe: 46.8 MB
Ella Morton takes us to Fort Tryon Park, home of The Cloisters for a little peace and quiet from the city. Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!
Datum: 22.06.2011 20:53 •
Größe: 13.1 MB
Ahoy! Today Molly tells us the tale of telephones, tipping points, death by electricity and who really won the current war. Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!?
Datum: 20.06.2011 14:39 •
Größe: 25 MB
Molly walks us through the a series of Presidential firsts, from the first to make a phone call to the first on twitter. Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!?
Datum: 17.06.2011 15:22 •
Größe: 13.3 MB
Today, Humanwire correspondent Kazim Raza visits with a family of bonded laborers in Pakistan.
To help or just to learn more follow this link: http://bit.ly/luFjgO
Click here for Show Credits.
Follow us on Twitter: @rocketboom
Like us on Facebook: facebook.com/rocketboom
Datum: 15.06.2011 18:41 •
Größe: 27.7 MB
In today’s episode, Molly talks about the phenomenon of stealing other people’s hair.
Click here for Show Credits
Follow us on Twitter: @rocketboom
Like us on Facebook: facebook.com/rocketboom
Datum: 13.06.2011 16:57 •
Größe: 47.2 MB
Molly discusses how the internet and social media effects TV shows today.
Click here for show notes.
Follow us on Twitter: @rocketboom
Like us on Facebook: Facebook.com/rocketboom
Datum: 10.06.2011 18:41 •
Größe: 87.8 MB
Ella Morton, on one of her many journeys through NYC, stumbled upon a dance parade. This is what she saw.
Click here for show credits.
Follow us on Twitter: @rocketboom
Like us on the Bookface! facebook.com/rocketboom
Datum: 08.06.2011 17:07 •
Größe: 99.6 MB
Molly outlines all the great apps to help your grandparents join the 21st Century.
Click here for show credits.
Follow Rocketboom on Twitter: @rocketboom
Like us on Facebook: facebook.com/rocketboom
Datum: 03.06.2011 15:18 •
Größe: 69.9 MB
Today on Rocketboom NYC, intrepid urban explorer Ella Morton gives the history behind one of the most famous landmarks in New York City: The Flatiron Building.
Click here for Show Credits.
follow us on Twitter: @rocketboom
Like us on Facebook: Facebook.com/Rocketboom
Datum: 01.06.2011 14:51 •
Größe: 55.5 MB
In today’s episode, Molly takes a look behind the curtain to reveal the mysterious world of Carnies.
Click here for show credits.
Follow us on Twitter: @rocketboom
Friend us on Facebook: facebook.com/rocketboom
Datum: 31.05.2011 15:16 •
Größe: 44.8 MB
Have you seen Pop-Tart Cat? Ever wonder where that song came from? WONDER NO MORE! Molly is here with the low-down.
Click here for show notes.
Follow us on Twitter for more interesting stories from around the Web: @rocketboom
Friend us on Facebook for more: facebook.com/rocketboom
Datum: 27.05.2011 17:16 •
Größe: 121.8 MB
Ella Morton travels to Williamsburg, Brooklyn to explore a place where you can go to get your Magic on: The Twenty Sided Store.
Click here for show credits.
Follow us on twitter: @rocketboom
Like us on Facebook: facebook.com/rocketboom
Datum: 25.05.2011 16:24 •
Größe: 75.2 MB
Molly runs down the new 3D technology out there.
Click here for show credits.
Follow us on Twitter: @Rocketboom
Facebook us: facebook.com/rocketboom
Datum: 23.05.2011 19:24 •
Größe: 106.4 MB
Today, Molly continues to entertain the notion that the world will end on Saturday, May 21, 2011.
Click here for Show Credits.
Follow us on Twitter: @Rocketboom
Friend us on Facebook: facebook.com/rocketboom
Datum: 19.05.2011 19:20 •
Größe: 147.4 MB
Today, Molly prepares you for the weekend. According to sources, this weekend marks the End of the World. Good night and good luck.
Check out show credits here.
Follow us on Twitter: @rocketboom
Friend us on Facebook: facebook.com/rocketboom
Datum: 18.05.2011 16:36 •
Größe: 73 MB
Molly investigates what happened to Sony during the now infamous hackings of Anon. Will it have long term affects for the Playstation?
Click here for show credits.
Follow us on Twitter: @rocketboom
Be our friend on Facebook: Facebook.com/rocketboom
Datum: 17.05.2011 02:10 •
Größe: 135.1 MB
In today’s episode, We visit take a look at Osama bin Laden’s mansion in MTV Cribs style. For more NMA videos visit NMA.tv Click here for show credits. Follow us on Twitter: @rocketboom Friend us on Facebook: facebook.com/rocketboom
Datum: 13.05.2011 16:28 •
Größe: 27.5 MB
Today on Rocketboom, Molly discusses the Apple suicide clause, Jetman, and more!
Click here for show credits.
Follow us on Twitter: @rocketboom
Friend us on Facebook: facebook.com/rocketboom
Datum: 12.05.2011 18:11 •
Größe: 46.6 MB
Today, NYC Explorer Ella Morton takes us all the way downtown to Chinatown to show us all about Bike Polo.
Click here for Show Credits.
Follow us on Twitter: @rocketboom
Friend us on Facebook: facebook.com/rocketboom
Datum: 11.05.2011 15:17 •
Größe: 57.9 MB
On today’s episode, Molly discusses the unsettling but inevitable meme-ification of Osama bin Laden’s death. Click here for show credits. Follow us on Twitter. Like us on Facebook.
Datum: 10.05.2011 20:42 •
Größe: 143.2 MB
Today on Rocketboom, Molly talks about why so many things taste like chicken!
Click here for show credits.
Follow us on twitter:@rocketboom
Like us on Facebook.
Datum: 09.05.2011 18:16 •
Größe: 55 MB
In 2001, members of an elite terrorist organization committed the worst attack on American soil. To this day, they haven’t been found. If you can find them, maybe you can capture: The AQ Team.
Click here for Show credits.
Follow us on Twitter: @rocketboom
Friend us on Facebook: Facebook.com/...
Datum: 06.05.2011 15:31 •
Größe: 75.5 MB
Today on Rocketboom, Molly explores the world of chess, from Magnus Carlsen to Deep Blue. Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!
Datum: 05.05.2011 18:08 •
Größe: 97.8 MB
Ella takes us to the heart of the Finance district to show us a bit of guerrilla art: The famous Wall Street Bull.
Click here for show credits: http://bit.ly/iA2lta
Follow us on Twitter: @rocketboom
Friend us on Facebook: facebook.com/rocketboom
Datum: 04.05.2011 17:23 •
Größe: 38.9 MB
Mother’s Day is coming up, so Molly called up her mom for some apps that everyone’s moms might like. Leave Molly a comment letting her know what sort of things you’re getting your mom for Mother’s Day. Click here for Show Credits. Follow us on Twitter: @rocketboom Friend u...
Datum: 03.05.2011 18:54 •
Größe: 81 MB
In today’s episode, Molly gives us the lowdown on all the things internetwise and jumps in with the latest scoop: Osama Bin Laden has been killed. #obl
Click here for show credits.
Follow us on Twitter: @rocketboom
Friend us on Facebook: facebook.com/rocketboom
Datum: 02.05.2011 19:50 •
Größe: 70.8 MB
In today’s episode, We take a trip across the country from sea to shining sea in a New York City Taxicab. Leave a comment about your worst Taxicab experience.
Click here for show credits.
Check out NMA online: www.nma.tv/
Follow Rocketboom on Twitter for the latest updates!
Like Rocketboom on...
Datum: 29.04.2011 15:29 •
Größe: 24.5 MB
In today’s episode, Molly gathers up stories of hoarders across the web. Are you a digital hoarder? Leave us a comment below telling us what kinds of things you hoard.
Click here for show credits.
Follow us on Twitter: @rocketboom
Friend us on Facebook: facebook.com/rocketboom
Datum: 28.04.2011 13:55 •
Größe: 60.9 MB
Today, Ella Morton visits one of the greatest spots in New York City: The Highline Park.
Click here for show credits.
Follow us on Twitter! http://twitter.com/rocketboom
Friend us on Facebook! http://facebook.com/rocketboom
Datum: 27.04.2011 14:17 •
Größe: 61.6 MB
On today’s episode [EAT TACOS!] Molly details the [EAT TACOS!] diabolical but dubious practice of [EAT TACOS] subliminal messaging. Click here for show credits. Follow us on Twitter! Friend us on Facebook!
Datum: 26.04.2011 20:48 •
Größe: 108.7 MB
On today’s episode, Molly fills us in on a brief history of copyright law in the music industry. RE-RE-REMIX!!! Click here for show notes. Follow us on Twitter. Friend us on Facebook.
Datum: 26.04.2011 01:39 •
Größe: 186.4 MB
For Casual Friday this week, Molly gets animated as she talks about the Gender Cake. NMA provided the animation. They’re awesome.
Click here for show credits.
Follow us on Twitter: @rocketboom
Follow us on Facebook: facebook.com/rocketboom
Datum: 22.04.2011 16:17 •
Größe: 27.6 MB
Today on Rocketboom, Molly tackles the hardest hitting topic today: Nicholas Cage and his amazing hair. Oh, and his heaping pile of crazy.
Click here for show credits: http://bit.ly/gUMZ1t
Follow us on Twitter: @rocketboom
Be our friend on Facebook: facebook.com/rocketboom
Datum: 21.04.2011 23:13 •
Größe: 26.1 MB
Rocketboom resident New York Expert, Ella Morton, checks in to give the low-down on the Sphere from the World Trade Center, currently in Battery Park.
Click here for Show Credits.
Follow us on Twitter: @rocketboom
Be our friend on facebook: Facebook.com/rocketboom
Datum: 20.04.2011 21:40 •
Größe: 20.4 MB
In today’s episode of Rocketboom, Molly gives us the skinny on that ubiquitous garment that everyone looks good in: Jeans.
Click here for show details.
Follow us on Twitter: @Rocketboom
Friend us on Facebook: Facebook.com/rocketboom
Datum: 20.04.2011 01:25 •
Größe: 46.2 MB
On today’s episode, Molly takes us into the future. Like way, way into the future. Click here for show credits.
Follow us on Twitter!
Like us on Facebook!
Datum: 18.04.2011 19:24 •
Größe: 21.4 MB
Today on Rocketboom, we have the exclusive first peek of Molly’s foreign language film, “Faire les yeux écarquillés de moi.”
Click here for show credits.
Twitter: @rocketboom
Facebook: facebook.com/rocketboom
Datum: 15.04.2011 15:52 •
Größe: 15.5 MB
In today’s episode, Molly explains why you won’t ever have more than 150 friends. Leave us a comment below telling us how you decide to cut your friends down.
Click here for show credits.
Follow us on Twitter: @rocketboom
Like us on Facebook: facebook.com/rocketboom
Datum: 14.04.2011 14:56 •
Größe: 38.1 MB
Today on Rocketboom, our Humanwire correspondent, Matt Brown, talks to Danny MacAskill about his stunt bicycle career and his films.
For more from Matt Brown: http://mattbrownfilms.blogspot.com/
Music by Blind Summit
Click here for show credits.
Follow us on Twitter: @rocketboom
Like us on Faceboo...
Datum: 13.04.2011 20:50 •
Größe: 41.8 MB
Molly takes us through a “choose your own adventure” scheme, in which you are the un-named ruler of a third world country. Can’t you make the right choices?!
Click here for show notes.
Follow us on Twitter: @rocketboom
Like us on Facebook: facebook.com/rocketboom
Datum: 13.04.2011 01:09 •
Größe: 21 MB
It’s Friday, Friday, gotta get down on Friday! And how do you do that? Solo Cups! Molly hits you with the history of this iconic beverage container. What’s your favorite use for Solo Cups? Leave us a comment below!
Click here for show credits.
Follow us on Twitter: @rocketboom
Like...
Datum: 08.04.2011 23:12 •
Größe: 32.2 MB
Today on Rocketboom NYC, Ella interviews Doo-Wop subway musicians Select Blendz at Doo-Wop Central. Some of the footage used for today’s episode was taken from Matt Finlin’s upcoming documentary ‘Below New York‘. For more info on todays episode, check out the wiki.
Follow Roc...
Datum: 07.04.2011 01:23 •
Größe: 39.5 MB
Today, Molly gives us some video game history, telling the tale of the Great Video Game Crash of ‘83.
Click here for show credits.
Follow us on Twitter: @rocketboom
Like us on Facebook: facebook.com/rocketboom
Datum: 05.04.2011 23:08 •
Größe: 34.6 MB
In Today’s Episode of Rocketboom, Molly regales us with the legend of Li Si, the man who invented Totalitarianism.
Click here for show credits.
Follow Rocketboom on Twitter for the latest updates: @rocketboom
Like Rocketboom on Facebook for behind the scenes pics and videos: http://facebook.co...
Datum: 04.04.2011 20:00 •
Größe: 24.1 MB
Today, Molly offers up twenty lies and one truth. Can you figure out which is true and which is not?
Click here for show credits
Follow Rocketboom on Twitter for the latest updates: @rocketboom
Like Rocketboom on Facebook for behind the scenes pics and videos: http://facebook.com/rocketboom
Datum: 01.04.2011 17:32 •
Größe: 14.3 MB
In today’s episode, Molly admits some embarassing secrets: She plays D&D. OH THE SHAME!
Click here for show credits: http://bit.ly/hbX1LS
Follow Rocketboom on Twitter for the latest updates: @rocketboom
Like Rocketboom on Facebook for behind the scenes pics and videos: facebook.com/rock...
Datum: 31.03.2011 20:49 •
Größe: 40.1 MB
Ruud Elmendorp reports on landmine-sniffing rats from Tanzania.
For more information on HeroRATs, visit their website at: http://herorat.org
Ruud Elmendorp: http://videojournalist.nl
Follow us on Twitter: @rocketboom
Like us on Facebook: Facebook.com/rocketboom
Datum: 30.03.2011 16:45 •
Größe: 57.4 MB
For the full announcement see htttp://blog.rocketboom.com
And also see…secrets please: http://meme.ly
Click here for show credits. Follow Rocketboom on Twitter for the latest updates. Like Rocketboom on Facebook for behind the scenes pics and videos.
Datum: 29.03.2011 16:11 •
Größe: 5.8 MB
LimeWire is sued for all the money in the world, organized religion is on the outs in nine countries, Jessi Slaughter’s dad hit the slammer, and so much more! Click here for show credits. Follow Rocketboom on Twitter for the latest updates. Like Rocketboom on Facebook for behind the scenes pic...
Datum: 28.03.2011 16:36 •
Größe: 23.4 MB
In Today’s Episode, Molly rocks your socks with some interesting Japanese memes!
Click here for show credits: http://bit.ly/fvKMZf
Follow Rocketboom on Twitter for the latest updates: http://www.twitter.com/rocketboom
Like Rocketboom on Facebook for behind the scenes pics and videos: http://fa...
Datum: 24.03.2011 23:04 •
Größe: 11 MB
In today’s episode of Rocketboom, Molly outlines the history of [points off screen] GODZILLA!
Click here for show credits: http://bit.ly/hUC5Fs
Follow Rocketboom on Twitter for the latest updates: http://www.twitter.com/rocketboom
Like Rocketboom on Facebook for behind the scenes pics and vide...
Datum: 23.03.2011 22:25 •
Größe: 39.2 MB
Molly gives an overview of the tragic devastation brought on by the worst tsunami in Japan’s history.
Click here for show credits: http://bit.ly/gXONSo.
Follow Rocketboom on Twitter for the latest updates: http://www.twitter.com/rocketboom
Like Rocketboom on Facebook for behind the scenes pics...
Datum: 21.03.2011 21:34 •
Größe: 28.3 MB
Rocketboom announces that it is busy preparing for next week’s episodes about the history and culture of Japan.
Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 17.03.2011 21:40 •
Größe: 223.6 KB
Molly checks in.
Click here for show credits. Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 11.03.2011 20:52 •
Größe: 1.8 MB
Today, Molly thinks.
Click here for show credits. Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 10.03.2011 21:17 •
Größe: 1.2 MB
Molly talks us through her top internet flash games as of late.
Click here for show credits. Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 05.03.2011 00:28 •
Größe: 23.4 MB
Once upon a time, Molly told us all about the young Barry and his struggle to overcome his dependence on cigarettes.
Click here for show credits. Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 03.03.2011 20:08 •
Größe: 21.9 MB
The future of the American worker is being decided on the streets of Madison, WI as tens of thousands of people protest at the Capitol every single day. Mary C. Matthews from The Transport Workers Union of America reports from Madison, WI.
www.twu.org
www.marymatthews.info
Click here for show credit...
Datum: 02.03.2011 21:10 •
Größe: 54.6 MB
Gaddafi on the outs, a Japanese hole-digging race, geese on the streets! All this and much more. Fast! Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!
Datum: 01.03.2011 17:44 •
Größe: 15.3 MB
In today’s episode, Molly talks about the recent struggles in Libya and how the world has responded.
Click here for show credits: http://bit.ly/g54Z4X
Follow Rocketboom on Twitter for the latest updates: http://twitter.com/rocketboom
Like Rocketboom on Facebook for behind the scenes pics and...
Datum: 28.02.2011 21:30 •
Größe: 27.5 MB
Today on Rocketboom, Ella Morton goes to Williamsburg to checkout the Brewskee-Ball headquarters, Full Circle Bar. Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!
Datum: 25.02.2011 17:15 •
Größe: 62.1 MB
In today’s episode, Molly makes a melange of modern messages, from Language to P. Diddy.
Click here for show credits.
Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!
Datum: 21.02.2011 18:03 •
Größe: 12.8 MB
Today on Rocketboom, Molly gets to the bottom of the question, “Where’s the cockfight?”
Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!
Datum: 18.02.2011 03:51 •
Größe: 31.4 MB
Today on Rocketboom NYC, Ella interviews Todd Lamb who leaves notes around the city to add interest to people’s lives.
Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!
Datum: 16.02.2011 23:56 •
Größe: 60.7 MB
Today Molly talks about historical pirates and their adherence to “pirate code.”
Click here for show credits. Follow Rocketboom on Twitter for the latest updates! LikeRocketboom on Facebook for behind the scenes pics and videos!
Datum: 15.02.2011 21:34 •
Größe: 32.3 MB
Molly fils us in on the potential for more revolution in the Middle East, Sony’s possible break with iTunes, and a cockroach at the Bronx Zoo you can name after your sweat-heart! Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for...
Datum: 14.02.2011 21:30 •
Größe: 17.3 MB
Today Molly talks about the story of Nokia from its beginnings to recent news of its impending fiery doom, as described by it’s CEO.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the latest updates!
Join us on Facebook for behind th...
Datum: 11.02.2011 02:03 •
Größe: 36.4 MB
Humanwire correspondent Matt Brown interviews employees and people training at Ice Factor, an indoor ice climbing facility in the Highlands of Scotland.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the latest updates!
Join us on Facebook...
Datum: 09.02.2011 22:18 •
Größe: 21.4 MB
Molly fills us in with a brief history of AOL and what they’re up to now. Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!
Datum: 08.02.2011 21:05 •
Größe: 37 MB
Today Molly talks about the Nasdaq hackers, Food Network comment trolling, the infiltration of China’s email network, and the Journal of Universal Rejection.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the latest updates!
Join us...
Datum: 07.02.2011 20:53 •
Größe: 21.2 MB
Animators Graham Mason and Nicole Boettcher bring us Part 2 of The Siege of Blackthorn Castle. Voices by Brantley Jones and Anna Abhau Elliott. Click here for show credits. Subscribe to our YouTube Channel for more Rocketboom! Follow us on Twitter for the latest updates! Join us on Facebook for b...
Datum: 05.02.2011 03:03 •
Größe: 16.9 MB
In today’s episode, Molly gives us the low down on such out of place artifacts as Greek Fire and the Antikythera device.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the latest updates!
Join us on Facebook for behind the scenes pi...
Datum: 03.02.2011 22:11 •
Größe: 23.1 MB
Today Molly talks about the potential fragility of our global network in light of the crisis in Egypt.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the latest updates!
Join us on Facebook for behind the scenes pics and videos!
Datum: 03.02.2011 00:20 •
Größe: 16.1 MB
Today on Rocketboom we look at the advantages of early education in daycares in South Africa. Humanwire correspondent, Ruud Elmendorp reports from Durban.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the latest updates!
Join us on Facebo...
Datum: 01.02.2011 23:43 •
Größe: 33.4 MB
Today Molly talks about the unrest in Egypt and it’s effects on the country’s internet access.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the latest updates!
Join us on Facebook for behind the scenes pics and videos!
Datum: 31.01.2011 17:55 •
Größe: 34 MB
Encore: Molly recounts the life of Edgar Allan Poe. Edgar Allen Poe?s Birth Home, Poe, Old Photo of Poe, Virginia Eliza Clemm Poe, Elizabeth ?Eliza? Arnold Poe, Portrait of John Allen, Cover: First Edition of Tamerlane, Tales of the Grotesque and Arabesque, Edgar Allan Poe?s Pit and the pendulum, P...
Datum: 28.01.2011 22:57 •
Größe: 70 MB
In today’s Episode, Molly tackles Egypt’s protests, their twitter blackout, the American Twitter Overload and President Obama’s State of the Union Address.
For show credits: http://bit.ly/gf05cM
Follow us on Twitter for the latest updates!
http://twitter.com/rocketboom
Join us on ...
Datum: 27.01.2011 17:23 •
Größe: 14.4 MB
Cook your delicious foods using sun light, and you don’t pay electricity, parafine, or firewood, and making it all a lot cheaper. That’s the promise of the solar cookers implemented by a South African company called Sunfire. They have been doing that for the last five years, and Sunfire ...
Datum: 26.01.2011 18:32 •
Größe: 40.5 MB
Today on Rocketboom, Molly investigates the truth behind the dark lord, Inglip, and his loyal followers the Gropagas. Click here for show credits. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos!
Datum: 25.01.2011 20:58 •
Größe: 16 MB
Today on Rocketboom, Molly covers stories of clean cabbies, Banksy’s identity and the return of Sherlock Holmes and 007.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the latest updates!
Join us on Facebook for behind the scenes pi...
Datum: 24.01.2011 18:15 •
Größe: 19.2 MB
Animator Graham Mason brings us the first installment of The Siege of Blackthorn Castle. Voices by Brantley Jones and Eddie Whelan. Click here for show credits. Subscribe to our YouTube Channel for more Rocketboom! Follow us on Twitter for the latest updates! Join us on Facebook for behind the s...
Datum: 22.01.2011 04:10 •
Größe: 5.6 MB
Molly takes us on a journey through her favorite food blogs. Headlines: Bread People, Cheese People, Grilled Cheese Social, Insanewiches, Scanwiches, Pretty Foods, Fuck Yeah Veggie Burgers, F Yeah Matthias’ Lunch, Misspelled Vegetables, Fancy Fast Food, Jim’s Cupcakes. Click here for sh...
Datum: 21.01.2011 12:00 •
Größe: 49 MB
Humanwire correspondent Calin Dinulescu reporting from Bucharest, Romania brings us an interview with Justin Capra, the Romanian inventor of the jetpack. Click here for show credits. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! J...
Datum: 19.01.2011 22:25 •
Größe: 39.6 MB
Today on Rocketboom, Molly takes us through the alphabet from Advice Dog to Zazaza.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the latest updates!
Join us on Facebook for behind the scenes pics and videos!
Datum: 18.01.2011 16:51 •
Größe: 6.9 MB
Today on Rocketboom, Molly takes us on a world tour of the news from sunrises that come too early in Greenland to punishing WikiLeaks founder, Julian Assange at Guantanamo Bay in Cuba.
Click here for show credits.
Subscribe to our YouTube Channel for more Rocketboom!
Follow us on Twitter for the lat...
Datum: 17.01.2011 14:32 •
Größe: 18.1 MB
In the final episode of the series, Jake explains everything to Carrie-Ann to try and save their marriage.
Save the Date was produced as part of the Rocketboom Filmmakers Program, an initiative that helps emerging filmmakers bring their visions to life on the Rocketboom network. To learn more about ...
Datum: 14.01.2011 15:28 •
Größe: 18.7 MB
Today on Rocketboom, Molly and friends take some snowballs to the face in ’snow motion’.
Follow us on Twitter for updates and friend us on Facebook for behind the scenes photos and videos.
Datum: 13.01.2011 14:09 •
Größe: 11 MB
Today on Rocketboom, Ella Morton speeds through Manhattan as she reenacts some of the best moments from Ghostbusters.
Follow us on Twitter and be our friend on Facebook for behind the scenes photos and videos.
Datum: 12.01.2011 15:16 •
Größe: 21 MB
Today on Rocketboom, Molly highlights the thought experiment that is the Two Generals’ Problem.
Follow us on Twitter @rocketboom and be our friend on Facebook for behind the scenes photos and videos.
Datum: 11.01.2011 15:18 •
Größe: 11.1 MB
Today on Rocketboom, Molly brings us stories from Pandas to Palin and back again. Click here for show credits. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter @rocketboom and be our friend on Facebook for behind the scenes photos and videos.
Datum: 10.01.2011 17:40 •
Größe: 24.5 MB
For the full list of episodes, go to:
http://www.rocketboom.com/savethedate/
http://rocketboom.com/save-the-date-ep9
Click on the link above for more info on today’s episode!
Jake tries to explain the situation to Carrie-Ann through her hotel room door.
Save the Date was produced as part of ...
Datum: 08.01.2011 00:17 •
Größe: 0.3 KB
Humanwire correspondent Ruud Elmendorp brings us an inspiring story of classical music lessons in the slums of Korogocho, Nairobi. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and...
Datum: 06.01.2011 23:13 •
Größe: 35.2 MB
Humanwire correspondent Ruud Elmendorp brings us a report on how Life Straws are changing millions of lives in Kenya. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 05.01.2011 17:55 •
Größe: 43.9 MB
Today on Rocketboom, Molly tells you how you can help her find new, significant, outstanding, unique, important, amazing, and awesome news stories. Click here for show credits. People are awesome, 4 chord song, snow put onto streets. Subscribe to our YouTube Channel for more Rocketboom Daily with...
Datum: 04.01.2011 15:16 •
Größe: 13.1 MB
Today on Rocketboom Daily, Molly reports on the growing world population and how little time we may have left. Click here for show credits. Glasses for Lonely People , First Observational Evidence Other Universes?, Democrats Crowdsourcing To Vote Palin In Primaries, Somebody Tell Me What All These ...
Datum: 03.01.2011 15:30 •
Größe: 19.4 MB
Click here for the full list of episodes!
Jake finds out about the Facebook picture and goes to confront Carrie-Ann. Click here for show credits.
Save the Date was produced as part of the Rocketboom Filmmakers Program, an initiative that helps emerging filmmakers bring their visions to life on the ...
Datum: 31.12.2010 13:41 •
Größe: 20.2 MB
2010 is almost over, and we’re celebrating with encore week! RocketboomTech’s Ellie Rountree interviews several students about their projects in this year’s ITP Spring Show. Click here for show credits. Short++, IKEA Robotics, MyCloud, Mobile Logger, More Projects from the ITP S...
Datum: 30.12.2010 14:40 •
Größe: 67.9 MB
2010 is almost over, and we’re celebrating with encore week! Rocketboom NYC?s Ella Morton interviews artist Justin Gignac of NYC Garbage. Click here for show credits. NYC Garbage, Yankee Stadium, New Years Eve NYC, RNC Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Foll...
Datum: 29.12.2010 13:54 •
Größe: 64.4 MB
2010 is almost over, and we’re celebrating with encore week! The Institute for Internet Studies explores the wild life of the troll. Click here for show credits. Stop Calling Me a Homo! joshu2uber For more memes visit KnowYourMeme. Follow us on Twitter for the latest updates! Join us on Fa...
Datum: 28.12.2010 04:59 •
Größe: 39.9 MB
2010 is almost over, and we’re celebrating with encore week! Here’s Molly’s favorite episode of Rocketboom Daily! Click here for show credits. Speed Skater, Smart Internet, Hummer, Hummer 2, Tengzhong Site, Barrels of Oil, Conan O’Brien Twitter, Article About Conan Picture...
Datum: 27.12.2010 13:41 •
Größe: 27.7 MB
Click here to watch Episode 8! Click here for the full list of episodes!
Kevin tells Susan and Molly to meet the groomsmen in the hall, and Lucy learns the secret. Click here for show credits.
Save the Date was produced as part of the Rocketboom Filmmakers Program, an initiative that helps emergin...
Datum: 24.12.2010 13:39 •
Größe: 25.2 MB
At the Institute of Internet Studies, the meme team looks back at some of the greatest memes of 2010. Click here for show credits. Epic Beard Man, F*cking Magnets, How Do They Work?, Bros Icing Bros, World Cup Vuvuzelas, Sad Keanu, Deal With It, Double Rainbow, Interior Semiotics, Antoine Dodson/B...
Datum: 23.12.2010 18:06 •
Größe: 61.8 MB
As we prepare for the new year, Molly looks back at the top ten worst moments from 2010. Click here for show credits. Conan vs. Leno, Haiti Earthquake, Volcano in Iceland, BP Oil Spill, Robert Green’s Fifa World Cup Fail, Mel Gibson, Copiapo Mining Accident, Gap Logo Revamp, TSA Body Scanner...
Datum: 22.12.2010 16:02 •
Größe: 34.7 MB
Ellie looks back at 2010 and gives us the top ten “top ten tech lists” of the year. Click here for show credits. The Top 10 Questions Tech Entrepreneurs Ask, Top 10 Obscure Google Search Tricks, Top 10 RSS and Syndication Technologies of 2010, Top 10 Tech Toys for Kids, Top 10 Tech Tur...
Datum: 21.12.2010 13:59 •
Größe: 14.7 MB
The year’s almost over, and there’s no better place end 2010 than New York City! Ella gives you the top ten things to do in New York before 2011. Click here for show credits. Punch Me Panda, Spider-Man on Broadway, Plaza Hotel, New York, Snooki to Drop From a Ball on New Year’s ...
Datum: 20.12.2010 12:05 •
Größe: 33.8 MB
Molly explains what Project For Awesome is, how it will affect YouTube, and how you can get involved. Click here for show credits. Film Aid, Project For Aweseome Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us on Faceboo...
Datum: 17.12.2010 13:27 •
Größe: 13.8 MB
Click here to watch Episode 7! For the full list of episodes, click here!
Things get tense when Leo realizes the mystery girl in Jake’s Facebook photo isn’t just a stranger. Click here for show credits.
Save the Date was produced as part of the Rocketboom Filmmakers Program, an initiat...
Datum: 17.12.2010 13:06 •
Größe: 24.7 MB
Today on Rocketboom Tech, Ellie gives you the run down on some of the hottest ways to capture a moment on the go! Click here for show credits. Hipstamatic App, The Mobile Photo Sharing Boom is Here, Picplz- Android, Stackr Mobile, Stealth Cam, Quadcam, Tilt Shift Generation Subscribe to our YouTub...
Datum: 16.12.2010 16:58 •
Größe: 34 MB
Today on Rocketboom Daily, Molly gives us the history of how Christmas tree lights made their way into the web and our hearts. Click here for show credits. $82,000 in electricity for this 1 million lights strong home, 65,000 LEDs, 200 individual channels, 500 hours, Insanely Awesome Christmas Ligh...
Datum: 16.12.2010 16:15 •
Größe: 34.3 MB
Ella takes a lesson in aided flight at Streb Lab for Action Mechanics in Brooklyn, NY. Click here for show credits. Streb Lab for Action Mechanics Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Follow us on Twitter for the latest updates! Join us on Facebook for behind the ...
Datum: 15.12.2010 14:36 •
Größe: 37.7 MB
Kenyatta is in danger of having his Twitter account become a wasteland of inactivity, and he needs your help! Click here for show credits. Visit What Should Kenyatta Tweet? to help Kenyatta save his account! Subscribe to our YouTube Channel for more Rocketboom! Follow us on Twitter for the latest...
Datum: 14.12.2010 16:34 •
Größe: 15 MB
Today on Rocketboom Daily Molly gives us the rundown on the latest trouble stirring across the pacific. Click here for show credits.
Google Trends “North Korea”, Kim Jong Il’s seocond son more interested in video games, Kim jong-il’s health and recreational drugs, North Kore...
Datum: 13.12.2010 17:27 •
Größe: 30.6 MB
Click here to watch Episode 6! For the full list of episodes, click here!
Leo finds out who Jake’s mystery kisser is and tries to contact her. Click here for show credits.
Save the Date was produced as part of the Rocketboom Filmmakers Program, an initiative that helps emerging filmmakers br...
Datum: 10.12.2010 14:36 •
Größe: 26 MB
Molly updates you on the latest developments in the situation surrounding WikiLeaks. Click here for show credits. Senator Joe Lieberman puts the heat on Amazon, Does Wikileaks have 1st Amendment case against Lieberman?, Amazon kills Wikileaks Account, Over 1000 Mirrored sites, Bank Freezes Julian&...
Datum: 09.12.2010 17:42 •
Größe: 33.4 MB
QR Codes seem to be everywhere these days, and each has a unique destination. Ellie gives you a look at some of the most popular QR code reading apps for your mobile device and where to find these elusive codes! Click here for show credits. Denso-Wave, Google URL Shortener, I-nigma, ScanLife, Qui...
Datum: 09.12.2010 16:42 •
Größe: 57.2 MB
Is city life driving you up a wall? Ella takes us to the perfect place in New York to climb out of that rut! Click here for show credits. Brooklyn Boulders Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Follow us on Twitter for the latest updates! Join us on Facebook for b...
Datum: 08.12.2010 14:30 •
Größe: 53.1 MB
Four Loko is being banned in New York City, so as a final goodbye to the drink, Molly shares her experience of the beverage with you! Click here for show credits. Four Loko Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us...
Datum: 07.12.2010 18:48 •
Größe: 41.4 MB
Molly prepares a plate of Giga Pudding for the happy folks at Rocketboom! Click here for show credits.
For more information on the Giga Pudding internet meme, visit KnowYourMeme.
Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Jo...
Datum: 06.12.2010 22:36 •
Größe: 30.3 MB
Click here to watch Episode 5! For the full list of episodes, click here!
The groomsmen try to secretly access Jake’s photo on Facebook to see what’s been upsetting Carrie Ann. Click here for show credits.
Save the Date was produced as part of the Rocketboom Filmmakers Program, an init...
Datum: 03.12.2010 14:08 •
Größe: 24 MB
Molly gives you the rundown on the latest corporate battle that is bringing the net neutrality issue into focus and may determine the future of the internet as we know it. Click here for show credits. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for ...
Datum: 02.12.2010 22:32 •
Größe: 28.3 MB
Ella speaks with Solomon Lederer about his idea to create a real-world social network on the New York subway. Click here for show credits. The Underground Connection Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Follow us on Twitter for the latest updates! Join us on Faceb...
Datum: 01.12.2010 13:55 •
Größe: 55.6 MB
Molly spreads the holiday cheer in New York’s Central Park by handing out free candy canes. Click here for show credits. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and vi...
Datum: 30.11.2010 18:35 •
Größe: 55.4 MB
People are stacking on top of each other in Spain, a wearable tent gives you instant privacy, and we carry a lot of old evolutionary leftovers. Click here for show credits. Ark Hotel Constructed in 6 Days, Human Castle Competition in Tarragona, Wearable Tent, Consequences of Human of Evolution, Al...
Datum: 29.11.2010 14:43 •
Größe: 16.5 MB
Click here to watch Episode 4! For the full list of episodes, click here!
The groomsmen are let in on Carrie Ann’s discovery and have to keep Jake from finding out. Click here for show credits. Save the Date was produced as part of the Rocketboom Filmmakers Program, an initiative that helps...
Datum: 26.11.2010 14:02 •
Größe: 42.6 MB
Happy Thanksgiving from Rocketboom! This year we put together cooking tutorials to show you how to create the perfect Thanksgiving meal! Simply click on any of the Rocketboomers on screen, and you’ll be taken to their own cooking segment featuring their dish in the living photo. Enjoy! Cli...
Datum: 24.11.2010 17:38 •
Größe: 6.8 MB
Molly speaks with Luke and Jason from Ministry of Magic about their wizard rock band and where this niche music genre is headed. Click here for show credits. Luke Conard, Jason Munday, Wizrocklopedia, The Leaky Cauldron Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow...
Datum: 23.11.2010 16:59 •
Größe: 26.2 MB
Internet Scientist Mike explains the origins and evolution of the classic GI Joe PSAs. Click here for show credits. For more memes visit Know Your Meme, and YouTube/KnowYourMeme. Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 23.11.2010 15:51 •
Größe: 42.7 MB
Today on Rocketboom Daily, dirt from Jim Morrisson’s grave goes on sale, extravagant dog houses show social status, and Tim Burton starts a story to be completed by followers on Twitter. Click here for show credits. Woman Sent to Labor Camp for Retweeting Someone’s Satirical Message, S...
Datum: 22.11.2010 15:03 •
Größe: 17.3 MB
Carl practices his dance moves with the guys before the wedding. Click here for show credits.
Save the Date was produced as part of the Rocketboom Filmmakers Program, an initiative that helps emerging filmmakers bring their visions to life on the Rocketboom network. To learn more about the program...
Datum: 19.11.2010 16:19 •
Größe: 0.3 KB
Welcome back to the Miniature Literature Appreciation Society! Today Molly reads a quatro submitted by @MuseaMagazine. Click here for show credits. Edward Martin III’s Carnival of Tiny Stories, Nanofiction, Tiny Stories on Twitter Subscribe to our YouTube Channel for more Rocketboom Daily w...
Datum: 18.11.2010 14:45 •
Größe: 7.6 MB
Ellie Rountree speaks with Anthropologist Genevieve Bell about her work with Intel to discover how technology has become a key component to 21st century life. Click here for show credits. Intel Research Labs
This episode was made in collaboration with Intel!
Subscribe to our YouTube Channel for t...
Datum: 18.11.2010 14:05 •
Größe: 24.7 MB
Inspired by the Harry Potter books, players and organizers of the game of Quidditch have turned a fantasy sport into reality! Click here for show credits. International Quidditch Association Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Follow us on Twitter for the latest u...
Datum: 17.11.2010 15:04 •
Größe: 71.8 MB
Internet Scientist Patrick analyzes the composition, origins and variations of the Tenso meme. Click here for show credits. For more memes visit KnowYourMeme Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 16.11.2010 16:34 •
Größe: 27.4 MB
Molly speaks with Popular Mechanics editor Seth Porges about the origin of pinball and it’s surprisingly dark past. Click here for show credits. Popular Mechanics, Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us on...
Datum: 16.11.2010 13:58 •
Größe: 60.1 MB
From #iamsparticus free speech protests to email domination and 4chan vs. Tumblr spam attacks, things are getting heated on the web! Click here for show credits. Campaign on Twitter in Support of #iamsparticus, Google vs. Facebook, Google Products, 4Chan Users Declare War on Tumblr Subscribe to ou...
Datum: 15.11.2010 14:19 •
Größe: 24.6 MB
An hour before Jake and Carrie Ann’s wedding, friends of the bride to be discover something that could ruin the big day. Click here for show credits.
Save the Date was produced as part of the Rocketboom Filmmakers Program, an initiative that helps emerging filmmakers bring their visions to li...
Datum: 12.11.2010 23:03 •
Größe: 0.3 KB
Molly tells you everything you need to know, and nothing more. Click here for show credits. Meat is Key to Male Tranquility, Whales Suffer Effects of Sunburn, Train Kills 20 Cows, Car-Struck Deer Flies Through Windshield, Out Back, Brain Gym Help Elderly Drivers Avoid Crashes, All Life on Earth Co...
Datum: 11.11.2010 14:15 •
Größe: 5.3 MB
Ever wonder how to fake an accent, especially a New York accent? Ella Morton speaks with dialect coach Amy Stoller to find out. Click here for show credits. Stoller System Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Follow us on Twitter for the latest updates! Join us o...
Datum: 10.11.2010 17:21 •
Größe: 32.4 MB
By African Renaissance Productions. Only 2,900 breeding pairs of Cape Vultures remain world wide. Kerri Wolter founded the Vulture Conservation Program in Magaliesberg, South Africa. Click here for show credits. Support Vulture Conservation, African Renaissance Productions Follow us on Twitter f...
Datum: 10.11.2010 14:47 •
Größe: 39.4 MB
Molly gives us a tour of the Babycastles arcade space, an independent art scene run by artists and game designers in New York City. Click here for show credits. Babycastles Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us...
Datum: 09.11.2010 14:51 •
Größe: 45.6 MB
Molly covers crab vending machines in Japan, Netflix streaming in Canada, Norway’s unmatched quality of life, and the real size of Africa. Click here for show credits. Japanese Crab Vending Machines, Between the Bars, Net Neutrality Protectors, Netflix Launches On-Demand Streaming in Canada,...
Datum: 08.11.2010 15:00 •
Größe: 27.5 MB
Save the Date is a ten part web series that takes place in real-time featuring Rocketboom Daily’s host, Molly. Written and directed by award-winning independent filmmaker Brett Haley, Save the Date revolves around the social media mishaps between a group of friends moments before two of the fr...
Datum: 05.11.2010 15:58 •
Größe: 6.2 MB
This episode was brought to you by the all new 2012 Ford Focus. Ellie gives us a look at several innovators in tech who are blending both technology and design in their products. 2012 Ford Focus Visit the Ford Focus on Facebook! Marius Watz Diana Eng MakerBot Industries Thingiverse Subscribe to ou...
Datum: 04.11.2010 18:51 •
Größe: 0.3 KB
Helium is running out, NASA has a new robot, and Virgin Galactic is selling tickets to space! Click here for show credits. Earth’s Supply of Helium is Running Out, Ustream live webcam of NASA Mars Rover construction, Virgin Galactic Booking Tickets, Cars Are Worse for Environment than Airlin...
Datum: 04.11.2010 18:50 •
Größe: 22.6 MB
Ellie sits down with MakerBot Industries CEO Bre Pettis to talk about his 3D printing device! Click here for show credits. MakerBot Industries Thingiverse
This episode was made in collaboration with Intel!
Subscribe to our YouTube Channel for the latest from Rocketboom Tech! Follow us on Twitter...
Datum: 04.11.2010 15:26 •
Größe: 41.7 MB
Humanwire Correspondent Lee Zucker reports. The Food Bank of Central and Northeast Missouri sponsors a program called the ?Buddy Pack Program.? Through this program, backpacks are donated to the food bank along with the food for elementary and middle school students. Students in need can pick up a ...
Datum: 03.11.2010 17:26 •
Größe: 38 MB
Internet Scientist Mike performs the Memexperiment of creating copypasta. Click here for show credits. For more memes visit: KnowYourMeme, YouTube/KnowYourMeme Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 02.11.2010 15:22 •
Größe: 18.9 MB
Today on Rocketboom Daily, Molly gives us a look into the big world of tiny stories. Click here for show credits. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 02.11.2010 14:28 •
Größe: 13.6 MB
Today on Rocketboom Daily, Molly covers the search for the missing unicorn, Al Qaeda’s latest threat, and TSA full-body scans that would make anyone uncomfortable. Click here for show credits. Missing Unicorn Flyer Found in New York City, Mythical Creatures Exhibit at Ontario Science Centre,...
Datum: 01.11.2010 17:35 •
Größe: 22.2 MB
Things get creepy at the Meme Institute when the power goes out and the internet scientists are left to tell scary stories! Click here for show credits. For more memes visit: KnowYourMeme and YouTube/KnowYourMeme. Follow us on Twitter for the latest updates! Join us on Facebook for behind the sc...
Datum: 29.10.2010 18:43 •
Größe: 0.3 KB
Halloween is upon us, and to celebrate the Meme Team carved a pumpkin into the classic ‘rage guy’ meme. Enjoy! Click here for show credits. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us on Facebook for beh...
Datum: 29.10.2010 12:12 •
Größe: 19.1 MB
Today on Rocketboom Tech, host Ellie Rountree gives an inside look into how AT&T works to recover failed networks after a disaster. Click here for show credits. AT&T Network Disaster Recovery, AT&T Network Disaster Recovery Equipment
This episode was made in collaboration with Intel!
...
Datum: 28.10.2010 20:47 •
Größe: 78.5 MB
Today on Rocketboom Daily, the U.N. deals with martians, the internet is killing film, and gloves are replacing keyboards. Click here for show credits. The United Nations Addresses Extra Terrestrial Life, Directors Blame Filmmaking Crisis on the Internet, CPR No Longer Deemed Most Helpful Resuscit...
Datum: 28.10.2010 19:06 •
Größe: 22.5 MB
For this year’s Halloween, Ella takes us through one of the scariest haunted houses in NYC! Blood Manor is now open until November 6th! Click here for show credits. Blood Manor Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Follow us on Twitter for the latest updates! ...
Datum: 27.10.2010 13:44 •
Größe: 59 MB
Today on Rocketboom Daily, Molly covers the Mayan doomsday, year-long supplies of food, the most accurate clock in the universe, and scented ink! Click here for show credits. Mayan Calendar is Out of Sync, A Year’s Worth of Food, Holometer, Scented Printing Ink Subscribe to our YouTube Chann...
Datum: 26.10.2010 18:18 •
Größe: 27.4 MB
Today on Rocketboom Daily, Molly gives us the scoop on Wikileaks, the latest battle with Cheap Trick and a new video exhibit from YouTube. Click here for show credits. Wikileaks more leaks from Iraq, Drop out of school for $100,000, YouTube Play at Guggenheim, New York Philharmonic Sues Cheap Tric...
Datum: 25.10.2010 19:46 •
Größe: 29.6 MB
Today on Rocketboom Tech, host Ellie Rountree speaks with Popular Mechanics’ Seth Porges about some of the gadgets from their 2010 Breakthrough Awards. Click here for show credits. Popular Mechanics, Breakthrough Awards 2010, Multipolar Magnets, CellScope, NASA LCROSS, STIHL HSA 65 Hedge Tri...
Datum: 22.10.2010 18:22 •
Größe: 47.3 MB
What makes the perfect pizza? An overload of internet memes of course! Click here for show credits. Get “Gimme Pizza: Meme Overload” on iTunes! Subscribe to our YouTube Channel for more Rocketboom! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scene...
Datum: 22.10.2010 14:26 •
Größe: 34 MB
Rocketboom’s Molly shows us the many ways peanut butter and jelly can be used to make the ultimate snack! Click here for show credits. Peanut Butter, Fruit Preserves Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us ...
Datum: 21.10.2010 19:42 •
Größe: 49 MB
What happens to a congested town when traffic lights are removed? Humanwire Correspondent Martin Cassini reports on this experiment performed in Somerset County, England. Click here for show credits. Fit Roads, Martin Cassini Follow us on Twitter for the latest updates! Join us on Facebook for b...
Datum: 20.10.2010 14:21 •
Größe: 45.5 MB
Rocketboom NYC host Ella Morton takes us on a wild ride through Manhattan in the annual “Broadway Bomb” skateboarding event! Click here for show credits. Bustin Boards, Broadway Bomb Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Follow us on Twitter for the late...
Datum: 20.10.2010 13:36 •
Größe: 59.8 MB
Vincent Moon sits down with Rocketboom host Molly to talk about his relationship with music and film in “The Take-Away Shows” and “La Blogotheque”. Click here for show credits. Vincent Moon, La Blogotehque, The Take-Away Shows Subscribe to our YouTube Channel for more Rocke...
Datum: 19.10.2010 16:10 •
Größe: 42 MB
Today on Rocketboom Daily, Molly gives us the rundown on mobile patent lawsuits, the overwhelming amount of McDonald’s restaurants in the U.S., blackouts, and a newly discovered mammal. Click here for show credits. Mobile Patent Lawsuits, North America a Slumbering Dragon, U.S. Power Network...
Datum: 18.10.2010 20:09 •
Größe: 28.6 MB
The World Wildlife Fund shows us the importance of creating sustainable fisheries to preserve the world’s fish populations. Click here for show credits. WWF Sustainable Fisheries Programme - SASSI, African Renaissance Productions, World Wildlife Fund Follow us on Twitter for the latest updat...
Datum: 15.10.2010 19:37 •
Größe: 48.1 MB
Today on Rocketboom Tech, host Ellie Rountree gives us a rundown of some of the best online tools for making your photos pop! Click here for show credits! Photo Tools Explained, Sumo Paint 2.0- Online Image Editor, Pixlr- Photo Editing Services, Upload Sharing Site by Pixlr, LunaPic Online Photo E...
Datum: 14.10.2010 21:31 •
Größe: 29.3 MB
Welcome to Rocketboom’s Animal Week! Today Molly tells us all about salamanders! Click here for show credits! Salamanders, IUCN Red List of Threatened Species, Invasive Species Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates...
Datum: 14.10.2010 17:44 •
Größe: 38.1 MB
A young girl takes care of an island of the coast of South Africa that is closed off for penguin conservation. Click here for show credits. African Renaissance Productions Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 13.10.2010 19:24 •
Größe: 0.3 KB
Today on Rocketboom NYC, host Ella Morton takes us through the insanely awesome pop culture experience known as the New York Comic Con! Click here for show credits. New York Comic Con Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 13.10.2010 13:26 •
Größe: 69.9 MB
Welcome to Rocketboom?s Animal Week! Today Molly tells us all about whales! Click here for show credits! World Wildlife Foundation, Save the Whales, Save the Whales Again, NOAA Whale Gallery, Whales, Cetacea
Datum: 12.10.2010 23:23 •
Größe: 0.3 KB
KnowYourMeme internet scientist Elspeth Jane gives us the cause and effect of the handsome meme we know as ‘Brother Sharp’. Click here for show credits! Brother Sharp image, Final Fantasy characters, Stylized hair, Brother Sharp fan photos, Guy Fawkes, Ned Kelly, Sun Wukong, Brian Boru...
Datum: 12.10.2010 17:52 •
Größe: 31.5 MB
Welcome to Rocketboom’s Animal Week! Today Molly tells us all about lemurs! Click here for show credits! Ring-tailed Lemur, Madagascar, Lemur, Strepsirrhini, Coquerel’s Sifaka, Sifaka, Aye-aye Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitte...
Datum: 11.10.2010 21:01 •
Größe: 49.6 MB
Molly reports from Paris, or at least that’s where she was when she shot the report… BUT THIS TIME SHE’S SLOWED DOWN!! Click here for show credits. Paris, Place de la Concorde, Musée du Louvre Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes ...
Datum: 08.10.2010 14:06 •
Größe: 15.1 MB
Feeling down? Well watch today’s Rocketboom Daily, and Molly will explain how thinking positive can actually be good for you! Click here for show credits. When positive thinking causes stress, Positive Mental Attitude, Why positive thinking is bad for you, Placebo effect, Self fulfilling pro...
Datum: 07.10.2010 13:00 •
Größe: 31.2 MB
In the Kenyan slum of Kibera, local craftsmen work to reuse discarded butcher bones and carve them into jewelry. Click here for show credits. Mobile Movement Funding for Victorious Youth Group, Ruud Elmendorp Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes p...
Datum: 06.10.2010 22:39 •
Größe: 32.9 MB
Rocketboom NYC host Ella Morton takes us to an odd and fascinating museum store filled with strange artifacts! Click here for show credits. The Evolution Store Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 06.10.2010 13:52 •
Größe: 52.5 MB
Molly reports from Paris, or at least that’s where she was when she shot the report… Click here for show credits. Paris, Place de la Concorde, Musée du Louvre Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us o...
Datum: 05.10.2010 14:55 •
Größe: 7.1 MB
Improve Everywhere hosted an event called “Mp3 Experiment Seven” that took place in Midtown Manhattan and ended with a crazy toilet paper party in Bryant Park! Click here for show credits. Improv Everywhere Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow ...
Datum: 04.10.2010 01:02 •
Größe: 61.3 MB
Rocketboom host Molly goes on a trip to Paris and stops by the 2010 Paris Motor Show! Click here for show credits. Ford, Ford Focus Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 03.10.2010 23:52 •
Größe: 34.5 MB
The term “Over 9000″ is an internet meme that originated in a Dragon Ball Z episode and is often used to describe “a lot” of something. Internet Meme scientist Mike gives us the history and evolving use of this fascinating meme. Click here for show credits. Arrival of Goku,...
Datum: 02.10.2010 16:47 •
Größe: 50.3 MB
Molly gives us a sneak peek into the highly acclaimed film, “The Social Network”, and discusses the growth of social media in recent years. Click here for show credits. The Social Network Official Movie Site, Facebook, Napster Follow us on Twitter for the latest updates! Join us on Fa...
Datum: 01.10.2010 17:22 •
Größe: 36.8 MB
Rocketboom Tech host Ellie Rountree takes us to the 2010 Maker Faire in New York to check out the latest and most original gadgets! Click here for show credits. Maker Faire http://makerfaire.com/, Dan Perrone http://www.danperrone.com/, Brooklyn Aerodrome http://brooklynaerodrome.com/, American In...
Datum: 30.09.2010 20:53 •
Größe: 77.2 MB
Today on Rocketboom Daily, Molly gives us the rundown on where the music industry is going and what’s up with social networks. Click here for show credits.
Social Network Content Creation Pleateaus. Bed Intruder on Billboard Charts Bed Intruder buys home for family Digitla Music Single Sales ...
Datum: 30.09.2010 18:25 •
Größe: 18.7 MB
Humanwire Correspondant Luana Di Pasquale reports on the efforts made by the Gorilla Organization to save the gorilla population through a fun and creative annual event. Click here for show credits. Artistic Films, The Gorilla Organization, The Gorilla Organization UK Follow us on Twitter for the ...
Datum: 29.09.2010 19:45 •
Größe: 0.3 KB
Today on Rocketboom NYC, host Ella Morton gives us a look at the only Hollywood stunt school on the East Coast! Click here for show credits. Hollywood Stunts Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Follow us on Twitter for the latest updates! Join us on Facebook for b...
Datum: 29.09.2010 14:13 •
Größe: 48.3 MB
Today on Rocketboom Daily, Molly takes us through the journey of human flight! Click here for show credits!
The Lament for Icarus Lord Frederick Leighton Eilmer of Malmesbury Leonardo Da Vinci’s design for the helical air screw Lilienthal’s glider Wright Brothers in 1910 Wright Brothers...
Datum: 28.09.2010 19:16 •
Größe: 29.9 MB
Today on Rocketboom Daily, Molly takes a trip to the Maker Faire to show us all kinds on new and interesting inventions! Click here for show credits!
Maker Faire: New York 2010
Subscribe to our YouTube Channel for more Rocketboom Daily with Molly!
Follow us on Twitter for the latest updates!
Join u...
Datum: 27.09.2010 22:36 •
Größe: 81.6 MB
Molly shows us how to create a work of art with a little help from pancake mix! Click here for show credits!
Follow us on Twitter for the latest updates!
Join us on Facebook for behind the scenes pics and videos!
Datum: 24.09.2010 19:03 •
Größe: 40.9 MB
Today on RocketboomTech, Ellie Rountree gives you advice on what to consider when purchasing a new TV. Click here for show credits!
This episode was created in collaboration with Intel!
Subscribe to our YouTube Channel for the latest from Rocketboom Tech!
Follow us on Twitter for the latest updates...
Datum: 23.09.2010 17:20 •
Größe: 32 MB
Today on Rocketboom Daily, Molly covers the decline in video games, human brain discoveries, and bacteria that can live 100 million years! Click here for show credits!
UK allowances dip, Video games improve decision making, Brain region controlling impulsive behavior isolated, Artic bugs hibernat...
Datum: 23.09.2010 15:46 •
Größe: 32.2 MB
Today on Rocketboom Daily, Molly talks about Elephants! From trunks to brain size, Molly shows us everything you need to know about these awesome animals! Click here for show credits!
oldest recorded elephant, cultural depictions of elephants
Follow us on Twitter for the latest updates!
Join us on...
Datum: 22.09.2010 17:20 •
Größe: 28.1 MB
24 year old Evans Wadongo invented a hand built solar lantern in Western Kenya, giving clean and affordable light to villagers in the region. And Click here for show credits.
Humanwire Correspondent: Ruud Elmendorp
http://videojournalist.nl/index.html
Follow us on Twitter for the latest updates!
J...
Datum: 21.09.2010 19:55 •
Größe: 29.7 MB
Click here for more info on today’s episode!
Today on Rocketboom Daily, Molly reports on China taking over the world, peace in the Middle East, and the fight for pancakes! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos! Click ...
Datum: 20.09.2010 19:52 •
Größe: 28.6 MB
Today Rocketboom Daily host Molly shows us some of her funniest bloopers! Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos! Click here for show credits.?
Datum: 17.09.2010 16:23 •
Größe: 15.5 MB
Today on Rocketboom Tech, host Ellie Rountree gives us the history of television and speaks with Brian Johnson from Intel about where it is headed in the future. This episode was made in collaboration with Intel! Click here for Show Credits: Subscribe to our YouTube Channel for the latest from R...
Datum: 17.09.2010 02:01 •
Größe: 40.1 MB
Click on the link above for more info on today’s episode! Molly updates us on an interactive wedding, a double-sided squeeze bottle, Weezer, a new Twitter application, and walruses. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest up...
Datum: 16.09.2010 17:50 •
Größe: 21.4 MB
Nollywood, or Nigerian Cinema, has become the second largest flim industry in the world. Famous for putting out thousands of new films each year, they have recently started to focus on improving the quality of their storytelling and production. Humanwire correspondent Dianna Dilworth reports from ...
Datum: 15.09.2010 23:08 •
Größe: 59.6 MB
Ella Morton interviews Kickstarter Co-Founders Yancey Strickler and Perry Chen about their NYC based company that helps people raise money to fund their creative projects. Click here for Show Credits. Subscribe to our YouTube Channel for the latest from Rocketboom NYC! Join us on Facebook for behind...
Datum: 15.09.2010 17:23 •
Größe: 27.8 MB
Molly has the latest on tractor beams, Banksy, dance moves, the laws of physics and more. Headlines: Banksy Dolphin, Most attractive dance moves revealed, Attractive Dance Moves, Sexiest Dance Moves for Men, New study suggests laws of physics vary throughout the universe, Working tractor beam can m...
Datum: 13.09.2010 14:53 •
Größe: 0.3 KB
Molly reads the dictionary. You wanted to see this. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 10.09.2010 19:50 •
Größe: 4.1 MB
Molly discusses the appearances of Jesus and Jellyfish. Justin Bieber uses 3% of Twitter resources and there is still traffic in Beijing.
Follow Rocketboom on Twitter for the latest updates. Like Rocketboom on Facebook for behind the scenes pictures and videos. Click here for show credits.
Datum: 09.09.2010 17:11 •
Größe: 19.5 MB
Ever feel like your cell phone could be your therapist? Well, today on Rocketboom Tech, host Ellie Rountree speaks with Intel’s Clinical Psychologist, Margie Morris, about how emotional needs can be met through mobile application technology. Click here for Show Credits.
Subscribe to our YouTu...
Datum: 09.09.2010 01:58 •
Größe: 46.9 MB
Kenyan DJ Mike Rabar turned his group of DJ’s, Homeboyz into an international entertainment group. From animation and television studios to schools for DJ’s and radio personalities, Homeboyz addresses the growing demand for production and event engineering in the Kenyan capital. From N...
Datum: 08.09.2010 19:18 •
Größe: 32 MB
Rocketboom NYC’s Ella Morton gets down with some clowns at the NY Clown Theatre Festival. Click here for Show Credits. Subscribe to our YouTube Channel for the latest from Rocketboom Tech! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 08.09.2010 16:10 •
Größe: 54.6 MB
Molly gives a brief history of diving. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos! Click here for show credits.
Datum: 07.09.2010 19:21 •
Größe: 53.1 MB
The Rocketboom Institute of Internet Studies examines the viral video that is Leeroy Jenkins. From the Know Your Meme Database: “Leeeeeeeeeeerooooy Jenkinnnnns is a catchphrase first screamed by a World of Warcraft player of the same name, just before ignorantly charging headlong into battle a...
Datum: 07.09.2010 05:04 •
Größe: 40.4 MB
Molly discusses unemployment, whether tap water is vegetarian and the first double hand transplant. Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos! Click here for show credits.
Datum: 06.09.2010 18:02 •
Größe: 28.1 MB
Molly interviews director Tommy Wiseau about his cult film The Room. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Join us on Facebook for behind the scenes pics and videos!
Datum: 03.09.2010 18:29 •
Größe: 28.8 MB
Molly reports on Apple, giant squids, and more. Click here for Show Credits. Headlines: Right to Ridicule followup: Brazil?s political comedy ban suspended, In Sports, free falling while cubing, New rocket design carries a single passenger, standing upright. Nose cone acts as a helmet. It?s like wea...
Datum: 02.09.2010 22:59 •
Größe: 45.6 MB
Molly interviews fans of The Room at the midnight screening at Village East Cinemas in NYC. Click here for show credits!
Datum: 01.09.2010 20:33 •
Größe: 45.6 MB
Rocketboom NYC’s Ella Morton interviews Dan the man behind Brooklyn Mobile, an internet video recording cart in Brooklyn, NY.
Datum: 01.09.2010 18:15 •
Größe: 50.2 MB
Today’s Humanwire report comes from Sulaymaniyah in Iraqi Kurdistan where an American group is currently doing a two week surgical mission to help address the growing issue of children suffering from heart disease in the region. Humanwire correspondent Jon Vidar brings us this report. If you...
Datum: 31.08.2010 18:33 •
Größe: 37.2 MB
Molly gives a tribute to creatures past. Click here for show credits. Subscribe to our YouTube Channel for more Rocketboom Daily with Molly! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 30.08.2010 17:32 •
Größe: 34.3 MB
Rocketboom Tech’s Ellie Rountree gives you some tech tips for the new school year! Subscribe to our YouTube Channel for the latest from Rocketboom Tech! Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos! Click here for show credits.
Datum: 30.08.2010 16:35 •
Größe: 32.7 MB
Internet Scientist, ElspethJane, from the Rocketboom Institute for Internet Studies investigates the phenomena of Antoine Dodson / Bed Intruder, his family, and his overnight success. Click here for show credits.
Datum: 27.08.2010 17:51 •
Größe: 42.1 MB
Molly talks about appropriate student/teacher social media relationships, recycling chewing gum, censorship in Brazil, the end of war in Iraq and the month-long traffic jam anticipated in China. Headlines: Teachers asked to unfriend students on Facebook, calling it ?inappropriate.?, Used chewing gum...
Datum: 26.08.2010 19:49 •
Größe: 30.8 MB
Graphic novels, comics, anime, manga & more! Rocketboom NYC’s Ella Morton visits Forbidden Planet’s New York Store. Click here for show credits.
Datum: 26.08.2010 01:30 •
Größe: 60.7 MB
Molly teaches you how to make a rainbow cake! Follow Rocketboom on Twitter for the latest updates! Like Rocketboom on Facebook for behind the scenes pics and videos! Click here for show credits.
Datum: 25.08.2010 16:28 •
Größe: 88.3 MB
Molly reports on the girl who cried baboon, plastic waste, and more. Headlines: Pilots on alert for high flying vulture, 14 year old girl trolls Missouri police department. A 14 year old girl claimed to have taken a picture of an escaped baboon in her backyard has turned out to be a hoax when police...
Datum: 24.08.2010 00:16 •
Größe: 25.8 MB
Encore! Play the Crocodile Paradox Game with Molly! Click here to start!
Datum: 21.08.2010 05:36 •
Größe: 1.9 MB
Molly reports on humanitarianism day, robots, bacteria-killing paint and more! Show Credits: Hooray for Humanitarianism Day! Headlines: Scientists create paint that kills 100% of deadly MRSA bacteria, expected to save 1/3 of people who die due to hospital-associated infections., 78 year old man mak...
Datum: 19.08.2010 18:40 •
Größe: 16 MB
Once a military base, now a park… Ella Morton of Rocketboom NYC visits Governors Island. For more info on this episode visit info.rocketboom.com
Datum: 18.08.2010 23:01 •
Größe: 67.9 MB
Mel West from Columbia, Missouri founded the all volunteer organization Personal Energy Transportation Project to bring low cost, hand cranked vehicles to those in need in developing countries. Since 1995, P.E.T. has delivered thousands of homemade wheelchairs to over 80 countries worldwide. Click ...
Datum: 18.08.2010 14:51 •
Größe: 37 MB
Molly welcomes you to the new decade. Headlines: Perseid Gallery, World?s Oldest Rocks in Canada, Hominin, Indian Pole Gymnastics. Click here for Show Credits: Welcome to the New Decade.
Datum: 16.08.2010 20:13 •
Größe: 37.6 MB
Molly’s dramatic reading of Kanye’s tweets.
Datum: 13.08.2010 17:27 •
Größe: 9.9 MB
Rocketboom Tech’s Ellie Rountree walks you through buying and setting up a wireless router. Click here for Show Credits: How to Install a Wireless Router.
This episode was created in collaboration with Intel!
Datum: 13.08.2010 16:42 •
Größe: 17.1 MB
Rocketboom NYC’s Ella Morton takes a tour of New York City as portrayed in the 1960’s-era TV show Mad Men.
Datum: 12.08.2010 01:28 •
Größe: 26.8 MB
Humanwire Correspondent Nergish Sunavala reports on the Hole In The Wall project to bring computers to rural India.
Datum: 11.08.2010 19:40 •
Größe: 29.4 MB
Who is Rube Goldberg? Where do his contraptions come from? Molly reveals the history of Rube Goldberg. Rube Goldberg, The Way Things Go, OK Go: This Too Shall Pass, University of California, Berkeley, San Francisco Chronicle, Rube Goldberg at Toonopedia, Rube Goldberg’s Political Cartoons, Geo...
Datum: 10.08.2010 20:07 •
Größe: 45.2 MB
International Day of the World’s Indigenous People, Animated map of nuclear explosions, 1945-1998, Health inspector shuts down 7-year-old’s summer lemonade stand, Infographic: Where Did the Money to Rebuild Iraq Go?, Secret Grilled Cheese Sandwiches Sold in New York. For show credits an...
Datum: 09.08.2010 14:52 •
Größe: 28 MB
Today’s Casual Friday “Spotlight” is from director Tomas Mankovsky - “Two fired up and freakishly excited hillbillies fight it out with fire and ice in the dark of night.” Click here for Show Credits: Dancing Pigeons - Ritalin.
Datum: 07.08.2010 13:31 •
Größe: 31.4 MB
Rocketboom Tech’s Ellie Rountree heads down to Washington, D.C. for the NASA Tweet Up. Click here for Show Credits: NASA Tweet Up.
This episode was created in collaboration with Intel!
Datum: 06.08.2010 05:54 •
Größe: 51.3 MB
Molly reports on the world’s fastest internet, insects, mind controlled artificial limbs and more! Click here for Show Credits: Mind Controlled.
Datum: 05.08.2010 14:56 •
Größe: 25 MB
Rocketboom NYC’s Ella Morton meets up with the Pickle Guys in NYC’s Lower East Side to learn more about the history of pickle making in the Big Apple. Click here for Show Credits: The Pickle Guys.
Datum: 04.08.2010 16:20 •
Größe: 59.7 MB
The Rocketboom Institute for Internet Studies investigates the similarities between two photo memes: Playing Dead and Lying Down Game.
Datum: 03.08.2010 21:23 •
Größe: 40.5 MB
Molly reports on lucid dreams, the human brain, and more. Headlines: Wikileaks Developer Detained at Border for Questioning, How North Korea could win a cyber war with one hacker, 100 Million Facebook Users Collected and Published, download here with bittorent, bittorrent, Cookie Madness, Hacker sho...
Datum: 02.08.2010 15:45 •
Größe: 27.1 MB
Molly gives you the grand tour of Central Park. Written, Directed, & Edited by Brett Haley. Director of Photography Tom Sawyer.
Datum: 30.07.2010 23:58 •
Größe: 74.7 MB
Molly walks you through Mag.ma. Visit Mag.ma to explore more and create your own account. Click here for Show Credits: Magma.
Datum: 29.07.2010 16:35 •
Größe: 52.3 MB
Rocketboom NYC’s Ella Morton gets the inside scoop on the UCB and their Del Close Marathon this weekend July 30 - August 1 in NYC. Click here for Show Credits: Upright Citizens Brigade.
Datum: 28.07.2010 16:14 •
Größe: 44.3 MB
Molly sets the record straight on some of the most misquoted quotations. Click here for Show Credits: Misquotations.
Datum: 27.07.2010 17:13 •
Größe: 29.3 MB
Infinite life, a long lived salamander, and autonomous robot vehicles. Molly takes on today’s news. BP Yet To Decide On CEO Replacement, Grim Questions Follow German Stampede, Wayward Alzheimer’s patients foiled by fake bus stop, Fleet of robot vans to journey from Italy to China ? with ...
Datum: 26.07.2010 15:47 •
Größe: 52.6 MB
Rocketboom Tech’s Ellie Rountree visits the B&H Super Store in NYC to get a few tips on what to look for when buying a new camera. This episode was made in collaboration with Intel! For show credits and more visit info.rocketboom.com.
Datum: 23.07.2010 17:00 •
Größe: 64.6 MB
Molly reports on the corpse flower, swedish tree hotels, and more. For show credits, visit info.rocketboom.com
Datum: 22.07.2010 16:49 •
Größe: 39.8 MB
Rocketboom NYC’s Ella Morton visits the factory of Steinway & Sons in Long Island City, NY to learn more about the history and making of one of the world’s oldest and most famous brands of pianos.
Datum: 21.07.2010 14:56 •
Größe: 58.4 MB
Molly explains the phenomenon of Paul the Oracle Octopus. For show credits: http://info.rocketboom.com/index.php?title=Octopus_Prediction
Datum: 20.07.2010 19:35 •
Größe: 47 MB
Washington Post: Top Secret America, Scientists say Gulf spill altering food web, Doomsday: How BP Gulf disaster may have triggered a ‘world-killing’ event, Untidy beds may keep us healthy, Kung Fu Barber Gives Upside Down Haircuts, U.S. Army Dips a Toe in Wind Power Waters, Tooele, Utah...
Datum: 19.07.2010 19:43 •
Größe: 37.3 MB
Molly talks to John Green, themightythor1212, geminite55, techfluff.tv, orabrush, livelavalive, totally sketch, marionhoney, nanalew, and ATTN about the future of YouTube and online video at Vidcon 2010. For episode credits visit info.rocketboom.com
Datum: 16.07.2010 20:30 •
Größe: 31 MB
Rocketboom Tech’s Ellie Rountree visits Spy Tec in NYC to learn more about spy technology. Click here for episode links and more info.
Datum: 15.07.2010 23:49 •
Größe: 85.5 MB
Molly interviews YouTube Musicians at VidCon 2010 including Dave Days, Rhett & Link, & Hank Green founder of DFTBA Records. For show credits, visit rocketboom info
Datum: 15.07.2010 22:57 •
Größe: 48.2 MB
Rocketboom NYC’s Ella Morton visits 5Pointz Aerosol Art Center, Inc. in NYC. Click here for Show Credits: 5Pointz.
Datum: 14.07.2010 22:39 •
Größe: 59.5 MB
Molly celebrates Bastille Day.
Datum: 14.07.2010 16:58 •
Größe: 9.6 MB
Molly interview iJustine, Meekakitty, and Brittani Louise Taylor at VidCon 2010. Click here for show credits: VidCon 2010: Ladies of YouTube.
Datum: 14.07.2010 06:40 •
Größe: 58.5 MB
Molly interviews John & Hank Green (Vlogbrothers) about VidCon 2010. Click here for Show Credits: VidCon 2010: Interviews with John & Hank Green of the Vlogbrothers.
Datum: 12.07.2010 15:55 •
Größe: 43.6 MB
Giant Double Rainbow. What does this mean? Rocketboom’s Institute for Internet Studies finds out.
Datum: 09.07.2010 20:40 •
Größe: 30.3 MB
Molly reports on the big wicked and sweet news of the day. LucasFilm Demands Wicked Lasers Stop Making Lightsaber-Like Laser, NASA’s Moonbase Alpha Serious Game, Ultime Réalité, Lone whales shout to overcome noise, Melon sells for £38,000 at auction, The Official Petition to Establish “H...
Datum: 08.07.2010 16:15 •
Größe: 42 MB
Rocketboom NYC’s Ella Morton interviews Professor DJ Raydar about this year’s Hip Hop Festival in NYC. Click here for Show Credits: Hip Hop Festival NYC.
Datum: 07.07.2010 14:52 •
Größe: 67.4 MB
Molly reports on the various types of tornadoes. Click here for Show Credits: Tornadoes.
Datum: 06.07.2010 12:56 •
Größe: 29.3 MB
Macy’s 4th of July New York City Fireworks Show 2010. Music: Hymn of the US Marshals by Goose Creek. With over 40,000 shells from all around the world, the NYC fireworks display was said to be the largest display in America. Rocketboom is giving away hi-res and uncompressed video files of the ...
Datum: 05.07.2010 15:42 •
Größe: 29.3 MB
Molly goes to her first 4th of July BBQ. Click here for Show Credits: The First Fourth.
Datum: 03.07.2010 15:29 •
Größe: 66.3 MB
Rocketboom Tech’s Ellie Rountree reviews 25 mobile applications for travel. Click here for Show Credits: Summer Apps.
This episode was created in collaboration with Intel!
Datum: 03.07.2010 05:11 •
Größe: 38.1 MB
Rocketboom’s Institute for Internet Studies explores the wild life of the troll. Click here for Show Credits: Know Your Meme: Troll Bait.
Datum: 02.07.2010 00:22 •
Größe: 43.7 MB
Molly reports on tech’s internal conflicts and more. Headlines: Obama to double available wireless broadband spectrum, Data servers could be used as energy sources, Your computer is made of “conflict materials” sourced from a bloody war in the Congo, EMILY the buoy-bot, Square Pixe...
Datum: 01.07.2010 15:45 •
Größe: 33.7 MB
Lost your marbles? Nail clippers? Rocketboom’s Humanwire correspondent, Charlie Inman, interviews street artist Asbestos about his series of Lost stickers. Click here for Show Credits: Lost - The Art of Asbestos. Music by Harry Love.
Datum: 30.06.2010 14:10 •
Größe: 32.7 MB
Molly goes behind the scenes with Casey McKinnon of A Comic Book Orange and Galacticast. Click here for Show Credits: Casey McKinnon.
Datum: 29.06.2010 15:20 •
Größe: 32.4 MB
Molly reports on the latest DMCA case, being caned for graffiti, North Korea and more. Headlines: YT Declares Victory in Viacom Case”, Cease&Desist LetterOliver Fricker caned for graffiti, Sense of touch influences thoughts and decisions, South Korea blasts pop music at North Korea, Rumor ...
Datum: 28.06.2010 22:56 •
Größe: 41 MB
It all begins … With a choice. ;-) Today’s Casual Friday was produced, directed, and edited by Brett Haley.
Datum: 25.06.2010 20:13 •
Größe: 32.6 MB
Rocketboom Tech’s Ellie Rountree has a few tips on tech and traveling. Click here for Show Credits: Tech Savvy Travel Tips. This episode was created in collaboration with Intel!
Datum: 24.06.2010 22:46 •
Größe: 36.1 MB
Molly reports on unicorn meat, lasers, stars, the iPhone 4, and more! Story links: Cease&Desist Letter, Unicorn Meat, ThinkGeekWeb1.jpg, Car View 1, Car View 2, Car View 3, Car View 4, Car View 5, Car View 6, Car Team Shot, Gruman Airship, Varanese 1, Varanese 2
Varanese 3, Varanese 4, Varanese...
Datum: 24.06.2010 17:06 •
Größe: 42.9 MB
Rocketboom NYC’s Ella Morton interview symbolic artist FOOX. Click here for Show Credits: FOOX. As Within So Without will be on display at the Lyons Wier Gallery from June 25 - July 20, 2010.
Datum: 23.06.2010 18:14 •
Größe: 31.1 MB
Molly reports on the history and future of vending machines. Click here for Show Credits: Vending Machines.
Datum: 22.06.2010 16:21 •
Größe: 28.7 MB
Molly reports on the summer solstice, the game of life, SpaghettiO’s recall, and more. Headlines: The Draconid meteor shower coming next year may cause some damage. NASA preps., NASA says the Moon has more water than the Great Lakes, 15 million pounds of SpaghettiO’s have been recalled, ...
Datum: 21.06.2010 17:02 •
Größe: 25.6 MB
Molly launches a rocket inspired by some of the first women in space, Valentina Vladimirovna Nikolayeva Tereshkova (Russian, 1963) and Sally Kristen Ride (American, 1983). Today’s Casual Friday was produced, directed and edited by Jesse Patch. Music by Keegan DeWitt.
Datum: 18.06.2010 22:52 •
Größe: 70.1 MB
Rocketboom Tech’s Ellie Rountree suggests a few of her favorite travel sites to help you find, book, and plan your next trip. Show Credits: Top Travel Sites for Summer. This episode was made in collaboration with Intel!
Datum: 18.06.2010 02:19 •
Größe: 49.2 MB
Molly interviews Plasticgod (Doug Murphy), celebrity artist & pop culturist, about the inspiration behind his work and how he uses social media to share his art. Show Credit: Plasticgod.
Datum: 17.06.2010 14:41 •
Größe: 31.8 MB
Rocketboom’s Humanwire correspondents Demetrius Wren & Christina Ghubril share the story of South Africa’s homeless World Cup team. From Us With Love.
Datum: 16.06.2010 15:39 •
Größe: 97 MB
Molly reports on the history and popularity of unicorns. Show credits: Unicorns.
Datum: 15.06.2010 14:49 •
Größe: 35.2 MB
Molly interviews Mike and Doug from Awkward Family Photos. For credits and more info on this episode, visit rocketboom.info
Datum: 14.06.2010 14:25 •
Größe: 25.4 MB
Internet Scientist ElspethJane of The Rocketboom Institute for Internet Studies explores the viral sensation that was Insane Clown Posse’s Miracles. To see credits on this episode, please click here.
Datum: 12.06.2010 07:46 •
Größe: 51.7 MB
Molly interviews Australian singer-songwriter and music producer Sam Sparro. For episode links and more, click here
Datum: 11.06.2010 14:50 •
Größe: 41.2 MB
Not sure what to get Dad for Father’s Day? Rocketboom Tech’s Ellie Rountree has a few recommendations - from apps to luxury boats - to help you out! For show credits and more info, visit rocketboom.info
This episode was created in collaboration with Intel!
Datum: 10.06.2010 20:00 •
Größe: 40.1 MB
Molly discusses World Cup forecasting, the architecture of memories, and teeny tiny fonts. For more info on this episode including show credits, click here
Datum: 10.06.2010 15:16 •
Größe: 39.1 MB
Rocketboom NYC’s Ella Morton visits the historic Economy Candy candy store in NYC’s Lower East Side. For show credits and more info visit: info.rocketboom.com
Datum: 09.06.2010 19:31 •
Größe: 51.1 MB
Molly wishes TBL a happy birthday and recounts his contributions to the Internet. Click here for show credits: Happy Birthday, Sir Tim Berners-Lee!
Datum: 08.06.2010 13:31 •
Größe: 36.7 MB
Molly reports on relative efficiency. Click here for show credits: Oil, Sweat, and Coffee.
Datum: 07.06.2010 16:04 •
Größe: 27.6 MB
Molly interviews Woody Tondorf of the ElevatorShow on YouTube. Click for Show Credits.
Datum: 04.06.2010 19:43 •
Größe: 30.9 MB
Rocketboom Tech’s Ellie Rountree learns about Intel’s newest netbook for education and kids: the Classmate PC. Intel recently released their newest version of the Classmate PC, which is a netbook specifically designed with children in mind. It runs with the Intel Atom processor, has a...
Datum: 04.06.2010 15:29 •
Größe: 72.9 MB
Molly is at the bat. Story links: China has 2nd most powerful supercomputer in the world, LiDAR reveals massive Mayan city, Sinkhole swallows up building in Guatemala, Phillipe Cousteau says the Gulf was already f’d before BP’s oil spill, totally f’d now, Energy expert recommends n...
Datum: 03.06.2010 15:29 •
Größe: 24.3 MB
Rocketboom NYC’s Ella Morton visits Bannerman Castle in the Hudson Highlands just outside of New York City. Assets: Moorish Architecture, Scottish Baronial architecture, old bed frame, outhouse, dc generator, castle wall, Map of New York.
Datum: 02.06.2010 15:19 •
Größe: 64.9 MB
Molly reports on the Darwins of the world. Assets: Galapagos Archipelago, Darwin island1, Whale Shark, Hammerhead shark, Galapagos shark, Hammerhead shark, Silky shark, Blacktip shark, Green turtle, manta ray, dolphins, shaking vending machine, man with no parachute, falling out window, Darwin’...
Datum: 01.06.2010 14:56 •
Größe: 29.9 MB
In spirit of Memorial Day, Ella Morton visits the USS Intrepid to learn more about the activities and history of Fleet Week in New York City. Assets: American Idiot Marquee, Hair Marquee, Ships coming in with Statue of Liberty, Overhead growler sub, Fleet week ship escort, Girls flirt with sailor,...
Datum: 31.05.2010 12:47 •
Größe: 46.4 MB
Molly interviews Tay Zonday. Assets: empty audience, city pages cover, webby award, streamy awards, tay w/ keyboard, chris crocker, soulja boy, miss south carolina, plane, boat, Reservoir Dogs, Wheel of fortune, A guy who really likes halo’s living room, How do I rained Chocolate?, Attack Of t...
Datum: 28.05.2010 18:55 •
Größe: 35.1 MB
Rocketboom Tech’s Ellie Rountree sits down with Seth Porges, Technology Editor at Popular Mechanics, to learn how to create your own mobile projections. Assets: popmech2, popmech3, wall project, 3dproject, projections, youtube, tshirt, make projections, VGA, 3m, street project, street art.
Thi...
Datum: 27.05.2010 20:32 •
Größe: 48.5 MB
Molly reports on news from famous dead guys…except one. Assets: mars1, mars2, Samuel C. Grave, Mark Twain, polish priest, cathedral 1, copernicus, jan matejko, mars3, shaved bieber tumbler blog, mars4, mars5, shaved bieber blog2, damaged mars, mars article, mars vid, shaved, old man, poland fl...
Datum: 27.05.2010 17:33 •
Größe: 30.3 MB
Today’s Humanwire episode was produced by Zackary Canepari & Drea Cooper: California is a place. In order to become a member of the Original Scraper Bike Team, you must: Be a resident of Oakland, CA. Be at least 7y/o or older. Retain A 3.0 Grade Point Average (GPA), Create your own Scraper...
Datum: 27.05.2010 02:00 •
Größe: 87.1 MB
The Rocketboom Institute for Internet Studies examines My New Haircut. Assets: Scientists, sunglasses at night, Mullet, Gotti broz, Mullet, Show Hype article, YepYep article, Urlesque article, Best Viral Hall of Fame, Guido Oompa, Haircut funniest video, COED Haircut article, Woosk article, Victoria...
Datum: 25.05.2010 20:12 •
Größe: 42.9 MB
Molly reports on Google TV. Assets: GoogleTV image, Logitech press kit, Google TV official announcement, Google’s Android Robot logo, Sony Logo, Intel Logo, Apple TV, google logo, Time Warner Rate change sheet, comcast Logo, google tv reference logo (small), Introducing google TV keynote, Time...
Datum: 25.05.2010 15:48 •
Größe: 34.2 MB
Molly reports on the search for life on mars, the creation of artificial life on earth, and the speculation of life on Venus. Assets: two shetland lambs, one lamb lying in grass, Iron Meteorite, Iron Meteorite 2, Geode, Geode Wide, Group of Rocks, Mounted Rocks and Minerals, night sky, Fluffy Cloud...
Datum: 24.05.2010 20:08 •
Größe: 33.8 MB
Molly performs the Bubble Wrap. Today’s Casual Friday was created by Ryan Hunter. Follow us on Twitter for the latest updates!
Datum: 21.05.2010 18:00 •
Größe: 17.5 MB
Rocketboom Tech’s Ellie Rountree gets the inside scoop on the Creators Project - a creative partnership between Intel and VICE Magazine. Assets: Spike Jonze, Sao Paulo, Seoul, Beijing, world map, New York, Brazil map, multi randolph, richie hawtin, karl sadler, heat map.
This episode was cre...
Datum: 21.05.2010 00:18 •
Größe: 78 MB
Molly reports on pranks, hoaxes, and misconceptions. Assets: Gerónimo Vargas Aignasse, Ball lightning magic card, Wikipedia Homepage, Ball lightnin’, Buddy Christ, Lightning orb, Human eye, lightning storm, Poloroid camera, Man_looking, Doc brown from Back to the future, waterbug, lizard, Doc ...
Datum: 20.05.2010 17:42 •
Größe: 46.2 MB
Rocketboom NYC’s Ella Morton visits the Chess District in Manhattan’s Greenwich Village. Assets: Marshall Chess Club, Bobby Fischer World Championship, Bobby Fischer, Washington, Square Park, Washington Square Park 2, Washington Square Park 3, Washington Square Park 4, chess match, chess...
Datum: 19.05.2010 15:24 •
Größe: 59 MB
Molly reports on turtles. Assets: turtle tomato, baby turtle, big turtle , i like turtles, leather back, leather back 2, jane goodall, jane goodall 2, philly zoo, philly zoo 2, longneck turtle, humane society turtles, bizarre exotic pets, darwin turtle dies
harriet turtle dead, Green Back Turtle,...
Datum: 18.05.2010 18:26 •
Größe: 44.1 MB
Molly reports on the latest Facebook security issues. Assets: email convo, photo blog, blog 1, blog 2, blog 3, chris pirillo, blog 4, fototopia, html page 1, flash website, flickr, webshots, piqshare, livejournal, baby sloth spirit, bad myspace page, fred wilson, facebook screen, private fb page, pu...
Datum: 17.05.2010 23:50 •
Größe: 32.5 MB
Report on the Deepwater Horizon oil spill from John Wathen of Alabama.
Datum: 17.05.2010 05:13 •
Größe: 35.3 MB
Molly interviews Steve and Zadi from Epic Fu. Assets: epic fu, next new networks, revision 3, epic fu jinx ad, USA map, epicfu 3D glass video, MIX epicfu.
Datum: 15.05.2010 19:07 •
Größe: 41.7 MB
Molly wishes Stephen Colbert a happy birthday, takes a quick studio tour around the city, and more. Assets: Siphoning Water, Siphon Drawing, Dilip Jeste, M.D., Brain With Beams of Light, Top View of Brain, Side View of Brain, Brain In A Jar, World Map: Political, Giant World Map, News, parliament, N...
Datum: 14.05.2010 03:44 •
Größe: 41.8 MB
Rocketboom Tech’s Ellie Rountree interviews several students about their projects in this year’s ITP Spring Show. Short++, IKEA Robotics, MyCloud, Mobile Logger, More projects from the ITP Spring Show 2010. Assets: Ikea Cart, Malm 1, Malm 2, Malm 3, Malm 4, Clouds, Clouds 2, iPhone Image...
Datum: 13.05.2010 23:29 •
Größe: 66.9 MB
Rocketboom NYC’s Ella Morton visits Roosevelt Island to learn about their Fast Trash program. Assets: ventilation stacks, Barcelona, London, Jetsons, Stockholm, roosevelt island ruins, roosevelt island main st, roosevelt island housing, roosevelt island assylum, roosevelt island prison, roosev...
Datum: 12.05.2010 14:29 •
Größe: 55.3 MB
Molly reports on some of the world’s most awesome bridges. Assets: Weinan Weihe Grand Bridge, telok blangah hill park bridge 1, telok blangah hill park bridge 2, telok blangah hill park bridge 3, bunker hill bridge1, bunker hill bridge 2, ponte vecchio bridge, ponte vecchio bridge 2, rialto br...
Datum: 11.05.2010 16:43 •
Größe: 37.9 MB
Molly reports hummus, robots, and more. Assets: Giant Hummus, Robot Stabbing Things, Stabbing Robot from Futurama, Robot Stabbing Web Article, Massachusetts General Hospital, Department of Defense Seal, slashdot article, tissue, tissue2, Thatte, pig heart, shoe, Tarriff, court, pbj, judge2, old cour...
Datum: 10.05.2010 11:36 •
Größe: 26.8 MB
Molly interviews Charlie Schmidt, the original Keyboard Cat video creator, and Brad O’Farrell, creator of the Play Him Off Keyboard Cat meme, at ROFLcon II where Charlie & Brad met each other for the first time after doing business together for over a year. Assets: Charlie Schmidt’...
Datum: 08.05.2010 16:54 •
Größe: 23.2 MB
Molly interviews Helen Killer from Regretsy.com at ROFLcon II. This episode is hydrated by vitaminwater! Assets: Bad Obama Paintings, Shag Rug, Etsy Frida Uterus pillow, Record candy bowl, regretsy: images
Datum: 07.05.2010 15:05 •
Größe: 39.8 MB
Rocketboom Tech’s Ellie Rountree recommends 8 gadgets you could buy your mom - tech savvy or not - for Mother’s Day! These are Ellie’s personal recommendations and are not paid promotions on behalf of any product or site. Assets: nikon coolpix, nikon2, nikon3, nikon4, nikon5, nikon...
Datum: 07.05.2010 01:29 •
Größe: 34.1 MB
moot from 4chan, Ben Huh founder of the Cheezburger Network, Jamie Wilkinson and Kenyatta Cheese from Know Your Meme, and Greg Rutter of Youshouldhaveseenthis.com discuss “Mainstreaming the Web” at ROFLcon II. Molly also interviews Tim Hwang, founder of ROFLcon & Jonah Peretti, found...
Datum: 06.05.2010 01:00 •
Größe: 53 MB
Molly interviews David DeVore and his son David, of the viral video hit David After Dentist at ROFLCon II in Cambridge, MA. Assets: tosh.o, graph, david after dentist, david on today show, operation smile, operation smile shot, DAD on CNN, DAD on Fox, DAD in Huffington Post, DAD in Washington Post,...
Datum: 04.05.2010 20:55 •
Größe: 46.1 MB
Molly interviews the Gregory Brothers - Andrew, Michael, Evan, and Sarah about their popular series Auto-Tune the News at ROFLCon II. This episode is hydrated by vitaminwater!
Datum: 03.05.2010 19:53 •
Größe: 37.4 MB
Rocketboom Tech’s Ellie Rountree visits Tech Heaven. Assets: Healthcare protest, From the labs 3D scanning with a camera, Tera Scale, ICRC, ICE, Innovation, Windows Linux, Reader Origins, Ben Foss, Experience Reader.
This episode was created in collaboration with Intel!
Datum: 01.05.2010 01:19 •
Größe: 63.9 MB
The Rocketboom Institute for Internet Studies explains how YouTube makes it easy to dispute a wrongful copyright claim. eff.org: A Guide to YouTube Removals, Center for Social Media: Code of Best Practices in Fair Use for Online Video
Assets: YouTube, Copyright, Music: Adagio for Strings.
Datum: 29.04.2010 16:26 •
Größe: 16.1 MB
The Rocketboom Institute for Internet Studies investigates the downfall of the Hitler Downfall meme. For more on this viral video, visit the Hitler Downfall meme entry at the Meme DB. To learn more about your rights under Fair Use, click here. Assets: fear drawing, dailymotion, vimeo, funny or die, ...
Datum: 29.04.2010 16:23 •
Größe: 21.4 MB
Rocketboom NYC’s Ella Morton interviews artist Justin Gignac of NYC Garbage. Assets: NYC Garbage, Yankees Stadium, New Years Eve NYC, RNC, St. Patrick’s Day in Ireland.
Datum: 28.04.2010 15:48 •
Größe: 64.1 MB
Molly meets up with YouTuber and actress Olga Kay. Assets: Music Video, Mooshistory, Fiesta, Movie, 50s, emogirl, US Commercials, Waynesworld.
Datum: 27.04.2010 19:51 •
Größe: 52 MB
Molly reports on Chernobyl, the recent BP oil spill, a robotic mouth, and more. Assets: chernobyl 1, chernobyl 2, radiation cloud, burning oil rig, bp’s spill, , oil skim 1, oil disperant, oil skim 2, x37b launch, Oil Spill From Rig Blats is 10 Miles Wide, X-37B Pre-Launch, X-37B Upright, X-37...
Datum: 26.04.2010 16:33 •
Größe: 31.5 MB
The Rocketboom Institute for Internet Studies investigates the trending phenomenon known as Standing Cat. For more on this viral video, visit the Standing Cat entry at the MemeDB! Standing Cat, Reuploads: 1, 2, 3, 4, 5, 6, 7, 8, 9], Standing Cat IN BOOTS! (Feat. Zorro Cat and Mariachi Cat), Japanese...
Datum: 23.04.2010 23:09 •
Größe: 23.7 MB
Molly performs Helena’s monologue from Act I, sc. 1 (line 212) from Shakespeare’s play “All’s Well That Ends Well” in honor of his death on this date in 1616.
Stuff in this episode: Chopin Mazurka, Elizabethan Serenade, curtains, stage, Bust of Shakespeare, alls well t...
Datum: 23.04.2010 13:28 •
Größe: 4.5 MB
Rocketboom Tech’s Ellie Rountree interviews Venmo co-founder Andrew Kortina about mobile payments. Assets: Cat on the phone, Cellphone, Apple II, Envelope, Red Cross, ABC News Report on Hati Text Relief, Percentage of Americans With Cellphones, iphone, Chipotle Burrito, Number of Americans wit...
Datum: 23.04.2010 04:46 •
Größe: 22.6 MB
In honor of Earth Day, Molly explains the “Carbon Footprint”. Assets: TI-99 computer, Ominous sky coal plant, coal plant, coal plant 2, bedroom, co2 smoke stack, nature, epa, terrapass, cool climate, footprint network, safe climate, carbon footprint, Power Plant, Map of the USA, Old hous...
Datum: 22.04.2010 14:15 •
Größe: 21.5 MB
Rocketboom’s Humanwire correspondent Cheikh Seck reports on flooding in Senegal.
Datum: 21.04.2010 18:05 •
Größe: 50.8 MB
Molly explains how velcro came to be. Assets: Light Bulb, Swiss Flag, Chamoflouge swatch, Hunting glasses, The alps, Gun, Cotton, Hello-kitty-microscope, Nylon Thread, velcro patent, velcro close-up, manchester NH, sylvia porter, rally photo, astronauts on moon, space suit test, skier, scuba diver, ...
Datum: 20.04.2010 14:31 •
Größe: 45.9 MB
Molly reports on the Iceland volcano and more. Assets: meteor article, Gehry, stata center, stata center 2, Memristor, transistor, brain activity, phone call, grocery list, robo cop unicorn, books on head, old college, volcano, eruption, lava, meteor footage, UW, Strata Center 3, WorldNetDaily, syna...
Datum: 19.04.2010 14:47 •
Größe: 33.5 MB
This Dish is based on a true story from animator Chris Dimino.
Datum: 18.04.2010 02:37 •
Größe: 62.6 MB
Rocketboom Tech’s Ellie Rountree visits the Intel Labs in Pittsburgh. Assets: Double Down Ad, An Actual KFC Double Down, Claytronics Videos. Music by Podington Bear - Hundy.
This episode was created in collaboration with Intel!
Datum: 16.04.2010 03:45 •
Größe: 73.1 MB
Molly reports on the Pope, MMORPGs, McDonald’s, Neptune, and more. Assets: Emma, dawkins vs emma., dawkins pic, times online screen, asteroids, asteroids close up, asteroids game, arcade player, MOCT South Korea, Heroes, 1 year old happy meal, Maple Teddy, triton wiki, robo plant, robo plant 2...
Datum: 16.04.2010 00:12 •
Größe: 35.8 MB
Rocketboom’s Humanwire Correspondent David Wardell reports on the Khmer Rouge trials being televised in Cambodia.
Datum: 14.04.2010 20:02 •
Größe: 34.5 MB
Rocketboom’s Research Institute for Internet Science explains Joseph Ducreux aka Archaic Rap with Elspeth Jane. Assets: “Get Low” Lil John and the Eastside Boyz, Ducreux Portrait, Ducreux Portrait in Frame, Portrait of Marie Antoinette by Ducreux, Run-DMC, Cool Moe Dee, Old School ...
Datum: 13.04.2010 21:04 •
Größe: 45.8 MB
Molly meets up with Joe Penna better known as MysteryGuitarMan on YouTube. Assets: T-Shirt Wars, Leave Brittany Alone.
Datum: 13.04.2010 15:49 •
Größe: 25.8 MB
Molly plays some sweet cat piano.
Datum: 12.04.2010 16:46 •
Größe: 35.3 MB
Rocketboom’s Humanwire correspondent Candice House speaks with Atlanta based graffiti artist Hense. Story links: Graffiti artist, Hense.
Datum: 09.04.2010 15:56 •
Größe: 38.5 MB
Rocketboom Tech’s Ellie Rountree visits the 2010 New York International Auto Show to find out how to connect your mobiles to your mobile. Be sure to also check out Ellie’s report on Green Driving: The Latest Innovations in Hybrid and Electric Cars from earlier this week!
This episode w...
Datum: 08.04.2010 20:00 •
Größe: 71.1 MB
Molly is out with the old and in with the new. Assets: Viper Bite On Finger, Viper Bite On Ankle, Viper Bite on Leg, Acne, Skin Disease: Large Rash, Skin Disease Eczema, Skin Disease, Yoda, Two and a half men dvd box, Commodore Store Web Site, Israel Distributes Biochemical War Protection Kits, Is C...
Datum: 08.04.2010 14:00 •
Größe: 40.8 MB
Rocketboom NYC’s Ella Morton gets the buzz on beekeeping at East New York Farms in New York City.
Datum: 07.04.2010 14:14 •
Größe: 63.9 MB
Rocketboom Tech’s Ellie Rountree visits the 2010 New York International Auto Show to check out the latest innovations in hybrid and electric cars. Assets: Nissan Leaf, Micosoft Hohm.
This episode was created in collaboration with Intel!
Datum: 07.04.2010 00:13 •
Größe: 67.8 MB
Rocketboom’s Internet Research scientist, Yatta, explains the curious case of Epic Beard Man. Assets: Epic Beard Man original video, Bring The Amber Lamps Video Loop, Thug Catches a Beat Down On Transit Bus, “Re: AC Transit Bus Fight I Am A Motherfucker”, AC TRANSIT BUS FIGHT I AM ...
Datum: 06.04.2010 13:49 •
Größe: 36.3 MB
Molly explains that things aren’t always what they seem to be. Assets: Splash the Orca from Sea World, Mountain Goat, Antelope, Red Panda at Smithsonian National Zoo, Single Tomato, Tomato Six Pack, Horned Toad on Rock, Meercat at London Zoo, Mongoose at Drusillas Zoo Park, UK, Goose Close Up ...
Datum: 05.04.2010 14:37 •
Größe: 7 MB
Molly goes on an easter egg hunt. Written, directed, and edited by Ryan Hunter. Story links: Google, Gamespot, Geek and Hype, Peta 2, Konami Code Sites, Homestar Runner, Lord of the Rings, HP Printer Plays Beethoven, New Super Mario Bros. Wii.
Datum: 04.04.2010 23:12 •
Größe: 16.4 MB
Rocketboom Tech’s Ellie Rountree interviews Jesse Davis, co-founder of Entrustet.com, a site dedicated to managing an individual’s digital assets after he/she has passed on. Assets: Tiger Woods, Firefighter, Tombstone, Picasa album, bunnies, Picasa logo, Facebook Logo, Delete key, Alien...
Datum: 02.04.2010 23:52 •
Größe: 34.8 MB
Molly reports on life discovered on the moon - bacteria named parvus lunar anatis, or “Moon Ducks“. Assets: moon craters, mallard duck, duck with ducklings, moon landing, Colorful Duck, Pair of Flying Ducks, Duck Close Up Head, Duck Flapping In Water, Duck Floating In Water, White Duck...
Datum: 01.04.2010 14:47 •
Größe: 22.1 MB
Rocketboom’s Ella Morton visits the Museum of the American Gangster in NYC. Assets: Prohibition car, we want beer, prohibition failed, repeal the 18th ammendment, tow truck, drive by shootings, Map, Fast Boats, Black Duck Rum Runner, Raid on Whisky, Barrels of Illegal Liquor, Gangster Being PR...
Datum: 31.03.2010 13:17 •
Größe: 26.4 MB
Molly is Serious Cat. Seriously.
Datum: 30.03.2010 13:17 •
Größe: 6.5 MB
Molly reports on more ugly animals. Assets: Garage Spider, Trilobite, Angler Fish, Cookie Cutter Shark, Axolotl, Kinkajou, Tarsier, Tubifex Worm, Goblin Shark, Dumbo Octopus, Platypus, Cuttlefish, Preying Mantis, Nautilus In Dark Water, Nautilus in Blue Water, Skinny Pig Close Up, Sarah Jessica Park...
Datum: 29.03.2010 16:36 •
Größe: 21.9 MB
Molly records her first time lapse video. Today’s Casual Friday was written, directed, and edited by Ryan Hunter. Starring MemeMolly and Jesse Patch.
Datum: 26.03.2010 20:31 •
Größe: 10.5 MB
Rocketboom Tech’s Ellie Rountree recommends 6 gadgets to help you multi-task in comfort and style. Assets: hagblog, saddle chairs, Studio Too Good, bibliochaise, multiple monitors, multiple monitors 2, multiple monitors 3, wall of monitors, multiple monitors 4, 4 monitors, sountina, sountina 2...
Datum: 26.03.2010 05:02 •
Größe: 24.6 MB
Molly recounts the life and career of Jacques-Yves Cousteau. Assets: “The Silent World” review, Cousteau article, Cousteau with figures, two-wheeled skates, model crane, battery-operated car, broken windows, boarding school, cousteau photos, naval academy graduation, cousteau photos 2, y...
Datum: 25.03.2010 13:37 •
Größe: 60.6 MB
Rocketboom’s Ella Morton interviews director Atom Egoyan and attends the red carpet premiere of Chloe, starring Julianne Moore, Liam Neeson, and Amanda Seyfried. Written by Erin Cressida Wilson and directed by Atom Egoyan. Chloe opens in the U.S. on Friday, March 26th. Assets: Cheating via Te...
Datum: 24.03.2010 14:00 •
Größe: 35.5 MB
Molly reports on ugly animals. Assets: Sameul Arbesman, mesofacts, Sanal Edamaruku: Tantra Challenge, Neil Degrasse Tyson pointing, Pluto, Pepsi , C-span footage of House bill passing.
Datum: 23.03.2010 14:22 •
Größe: 29.2 MB
Molly reports on the world’s oldest trees. Assets: Painting: Castagno dei cento cavalli - Jean-Pierre Houël, Photo: Castagno dei Cento Cavalli, Jhomon Sugi in Yaku Island Japan, Jomon Sugi Panorama, The Senator, Prometheus 1, Prometheus 2, Bristlecone Pine, Picea Abies, Aspen Overview Pando, P...
Datum: 22.03.2010 16:58 •
Größe: 42.8 MB
Molly explores Austin, TX during SXSW to find out how people are keeping it weird. Assets: austin downtown, austin capitol building, selecting hand, Greetings from Florida! (Photoshopped, reference), bridge, bats, Cove, Austin, Austin, HDR, Bay, Austin, Nature, Austin, Bridge, Austin, Morning
Datum: 20.03.2010 00:38 •
Größe: 47 MB
Rocketboom Tech’s Ellie Rountree interviews Mike Barger from AT&T with a first look inside the technology that powered SXSW 2010. This exclusive interview also reveals AT&T’s plans to make available small, personalized signal boosters for the home later this year. Assets: Backhau...
Datum: 18.03.2010 12:23 •
Größe: 63.8 MB
Rocketboom’s Humanwire correspondent Tim Brown reports on Bee Beard from Portland, Oregon.
Datum: 17.03.2010 19:10 •
Größe: 32 MB
Rocketboom’s Humanwire correspondent Ruud Elmendorp reports on self defense classes for the elderly women in Korogocho, Nairobi, Kenya.
Datum: 16.03.2010 01:29 •
Größe: 35.8 MB
Molly takes a trip down the rabbit hole. Today’s Casual Friday was produced, directed, and edited by Ben Conley.
Datum: 13.03.2010 00:02 •
Größe: 15 MB
Molly discusses the pyramids. Assets: Koh Ker Temple Pyramid, Tikal Taken Temple Pyramid, Rupert Sheldrake, Woman Staring at Small Crystal Ball, Guy With Hands, John Noble Wilford NYTimes Page, Thomas F. Strasser, Ph. D., Robert Schoch, Boston University, Voyages of the Pyramid Builders Book Cover, ...
Datum: 11.03.2010 15:56 •
Größe: 40 MB
Rocketboom’s Ella Morton interviews Andrew Beccone, master librarian and founder of the Reanimation Library in Brooklyn, NY. Assets: Raul Hausman Dada poster (1923-1924), Raul Hausman “The Art Critic” dada image, Dada art: Max Ernst, brooklyn map. Music by Podington Bear.
Datum: 10.03.2010 14:38 •
Größe: 47.3 MB
Molly shares her thoughts on sound, laziness, Alice in Wonderland and more. Assets: Édouard-Léon Scott, Phonautograph, first audio recording, theweakshop.com, ashamed puppy, damien hirst, the clinic, Hirst - “The Impossibility…”, Singapores Medical Restaurant, Singapore Swing, nitr...
Datum: 09.03.2010 14:35 •
Größe: 21.7 MB
Molly discusses star wars, classical music, portal, and more. Assets: Tbilisi Rock Festvial, “Aquarium at Tbilisi”, Regan, Regan with Flags, Reagan at Empire Speech, Vader Imperial March Music, Regan’s Star Wars, Regan Star Wars Stamp, Star Wars Trailer, No Loitering, LoudSpeaker, ...
Datum: 08.03.2010 19:58 •
Größe: 37.6 MB
Molly predicts this year’s Oscar winners. Join her for the Oscar Prediction Game by submitting your predictions in the comments below, or making a video response on our YouTube channel! Click here for Molly’s list! Assets: Up In The Air Trailer, Inglourious Basterds Trailer, District 9 T...
Datum: 05.03.2010 16:58 •
Größe: 48.2 MB
Rocketboom Internet Research Scientist, Jamie W., explains Phonetic Translations. Story links: Scuse Me while I kiss This Guy - Jimi Hendrix, Creedence Clearwater Revival: Bad Moon Rising, misheard, Even Flow: Misheard Lyrics, Misheard Lyrics: Sean Paul - Temperature, Britney Spears: Toxic Misheard ...
Datum: 04.03.2010 15:01 •
Größe: 34.6 MB
Rocketboom’s Ella Morton visits the Morbid Anatomy Library. Assets: Victorian Romance, Suitor, Man on Bended Knee, Fashion Plates, Thrillers Club, Woman Laying Nude,Victorian Fashion, Panmosaic, Mercury, Weight in Gold, Pompeii Wall Painting, Pompeii Brothel, Roemer 2, Roemer 1, Aphrodite Anad...
Datum: 03.03.2010 15:41 •
Größe: 32.9 MB
Molly tells the tale of Dr. Seuss in honor of his birthday. Assets: Dr. Seuss with wife, Dr. Seuss with pipe, suess with doll, jacko magazine, oxford, beer bottle, judge and life, animation - private snafu, gasmask training, to think that i saw it on mulberry st, butter battle, illustration, from gr...
Datum: 02.03.2010 14:22 •
Größe: 49.8 MB
Molly reports on Justin Bieber’s birthday, Conan on Twitter, nuclear waste on asteroids, Hummer going out of business, and more. Story links: Tron Movie Poster, Speed Skater, smart internet, hummer, hummer 2, hummer 3, tengzhong site, barrels of oil, conan obrien twitter, article about conan ...
Datum: 01.03.2010 23:14 •
Größe: 24.8 MB
An emergency weather report from Molly, Molly, and Molly. Assets: Japanese Smiling Dog. Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 26.02.2010 21:40 •
Größe: 12.6 MB
Molly interviews Mortified creator and founder Dave Nadelberg. Assets: Home Video, Diary. Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 25.02.2010 14:44 •
Größe: 30.6 MB
Rocketboom’s Ella Morton interviews Natalie Tran also known as Community Channel on YouTube. Music by Podington Bear.
Datum: 24.02.2010 15:01 •
Größe: 63.3 MB
Rocketboom Tech’s Ellie Rountree gives some advice on being a tech collector. Story Links: History of the Internet, e-waste, where old computers go to die, old tech on ebay, Old Nintendo system sells for $13,105, Rarity Guide, Brick Phone, Extra Thick Brick Phone, Collectible Mobile Phones, De...
Datum: 23.02.2010 15:01 •
Größe: 44.6 MB
Molly reports on Epic Beard Man and more. Assets: Buy a Tech Firm, Get a Ping Pong Table, Equation, Epic Beard Man, Cleveland Skyline, Texas, Texas 2, Cleveland City Hall, Cleveland House, Bob’s Pickle Pops, Cow Madness, Cleveland Most Miserable City
Datum: 22.02.2010 15:50 •
Größe: 23 MB
Molly talks Leah into trying to get arrested by breaking some wacky laws around New York City. Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pics and videos!
Datum: 20.02.2010 02:34 •
Größe: 24.7 MB
Molly visits Toy Fair 2010 in NYC to get a look at some of this year’s greatest toys.
Datum: 19.02.2010 14:32 •
Größe: 47.8 MB
Rocketboom’s Humanwire correspondent Harvey Stein reports from Jerusalem, Israel about the celebration of Elvis’ birthday at the Elvis American Inn.
Datum: 17.02.2010 14:43 •
Größe: 60.6 MB
Molly recites her A, B, C’s… Story links: Tribute to Steve Ballmer, California Coastline, California Coastline 2, Large Hadron Collider Delay, Shortest Street on Earth, Surprising Animal Facts, iBap Jeans for the iPad, Jelly Fish Challanger, Karaoke Rage, Super Mario 64, Canadian NATO Sp...
Datum: 16.02.2010 09:08 •
Größe: 14.5 MB
Molly talks about land opportunities, the Olympics, and more. Story links: Nodar Kumaritashvili [pic 1], Nodar Kumaritashvili [pic 2], Nodar Kumaritashvili [pic 3], Nodar Kumaritashvili [pic 4], Nodar Kumaritashvili [pic 5], Crow-Bot, Ogori Cafe, Ogori Chart, Luxury Float, Map of Bir Tawil, Map of M...
Datum: 15.02.2010 14:45 •
Größe: 31.9 MB
Molly makes Valentine’s cards and spreads the love around Central Park in New York City. Leave your best Valentine’s Day story as a video response or in the comments below and you could win the last of Molly’s Valentine’s cards! Music by Gepel. For the latest updates, follow ...
Datum: 12.02.2010 19:19 •
Größe: 32.9 MB
Rocketboom Tech’s Ellie Rountree explains 3D viewing technology. Story links: View Finder, 1954 DIAL M FOR MURDER, 3-D Film, Anaglyphic plastic 3D glasses, Polarization, Alternate frame sequencing, Autostereoscopic, 3D Film and Animation Getting it Right, Digital Light Processing, DLP Backgrou...
Datum: 12.02.2010 14:24 •
Größe: 33.8 MB
Molly explains “power couples” and how Brangelina came to be. Story links: E! News, Meet the Smiths, Google search for Brand and Angelina Split, Brangelina US Weekly, Brangelina OK magazine, Brangelina Split Rumors, The Brangelina Fever, Robert Thompson Assets: Gone With the Wind, JFK an...
Datum: 11.02.2010 17:50 •
Größe: 42.8 MB
On today’s Humanwire episode, watch TWU Local 525 members discuss their worries about the future of their jobs, their industry and their communities, which rely on the current model of space exploration for their survival. Mary C. Matthews reports from Cape Canaveral, Florida. Story links: Uni...
Datum: 10.02.2010 22:01 •
Größe: 47.8 MB
Molly explores the website Chatroulette.com and chats with people from around the world. Follow us on Twitter for the latest updates! Join us on Facebook for behind the scenes pictures and videos!
Datum: 09.02.2010 18:17 •
Größe: 18.3 MB
Molly reports on defense bots and more. Story links: Hydro Electric Power Plant Explosion, The Frozen Explosion Power Plant, Ice House Detroit, Coudal, full moon, Ice House Detroit Blog, Boston Dynamics Big Dog, DARPA asks Boston Dynamics for Bigger Big Dog, No joke: South Carolina now requires ?su...
Datum: 08.02.2010 14:27 •
Größe: 26.9 MB
Molly goes to her first Super Bowl party. This week’s Casual Friday was written, directed, and edited by Ryan Hunter. Starring: MemeMolly, Jenn Lyon, Taige Jensen, Neal Bledsoe, Brett Haley, and Andrea Vascellari.
Datum: 05.02.2010 21:20 •
Größe: 24.5 MB
Rocketboom Tech’s Ellie Rountree reviews 6 new applications for you to try on your Mac and/or PC! Applications: Things, Team Viewer, Self Control, Last Pass, Songbird, Party Booth.
Datum: 05.02.2010 00:21 •
Größe: 37.1 MB
Molly celebrates Create a Vacuum Day by conducting the “egg in a bottle” experiment. Assets: Safety First, Crash Test Dummies, Fireman.
Datum: 04.02.2010 14:33 •
Größe: 23.8 MB
Rocketboom’s Ella Morton interviews Dom Villella and discovers the paranormal side of New York City. Assets: asleep in bed, ghosts, clocks. Music by Podington Bear.
Datum: 03.02.2010 21:22 •
Größe: 37.3 MB
Molly reports on Apple’s iPad. Assets: ipad, mac desktop, photoshop interface, fcp interface, vhs camcorder, rotary phone, hard drive, ipad present, leaning forward at desk, looking at iphone, reclining, reclining 2, reclining 3, layin on grass, handing it over, Adobe Flash, Missing Flash, Mis...
Datum: 02.02.2010 20:53 •
Größe: 33.4 MB
Molly reports on an island in a lake on an island and more. Story links: Philippine island qualifies its way to a “World’s Largest” title, What to get the man who has everything? An underwater plane of course, Try air to stay dry, NASA, Valentine’s Delieverd from Space, A Too...
Datum: 02.02.2010 06:20 •
Größe: 33.3 MB
Rocketboom’s Internet Research Scientist, Jamie W., explains Advice Dog. Assets: post of year, 76M GET, acid trip, adult swim, original advice dog, drink motor oil, Browse 4chan, Regret Life, Buy Lingerie, For Your Mom, Kill Hookers, No One Will Mind, That You’re Naked In Public, Pirate ...
Datum: 29.01.2010 18:37 •
Größe: 30.6 MB
Molly recounts the life of Edgar Allan Poe. Assets: Edgar Allen Poe’s Birth Home, Poe, Old Photo of Poe, Virginia Eliza Clemm Poe, Elizabeth “Eliza” Arnold Poe, Portrait of John Allen, Cover: First Edition of Tamerlane, Tales of the Grotesque and Arabesque, Edgar Allan Poe?s Pit an...
Datum: 28.01.2010 23:05 •
Größe: 53.5 MB
Rocketboom’s Ella Morton visits Yelo Spa in New York City to learn about the benefits of power napping.
Datum: 27.01.2010 17:14 •
Größe: 25.5 MB
Molly reports on exploding animals. Assets: ant battle, paintball exploding, cat 1, cat 2, dog 1, dog 2, suspended animation, squirrel, humans in suspended animation, beached whale, whale on crane, whale on truck, clean up after whale, darwin w/ pokeball, raining fish, toad, dead toad, grass, pig in...
Datum: 26.01.2010 15:40 •
Größe: 20.3 MB
Rocketboom Tech’s Ellie Rountree interviews Boxee founders Avner Ronen and Idan Cohen. Boxee is a featured app in the Intel Atom Developer Program for MIDs. Music by Podington Bear.
This episode was created in collaboration with Intel!
Datum: 25.01.2010 15:16 •
Größe: 109.7 MB
Molly discusses the Conan Leno battle over late night. Assets: new york night shots, leno on carson, letterman first nbc, first jay leno tonight show, tea party footage, tea party 2, Conan supporters protest, Trendistic - graph of Conan/Leno, twitter - team coco hashtag, I’m with Coco, franken...
Datum: 23.01.2010 15:50 •
Größe: 42.1 MB
Molly reports on NASA, China, and the ISS. Check out our Save the Space Station wiki page. Story links: Apollo, Russia Offers a Hand With Toilet Clog in Space , NASA Slashes Price for Used Space Shuttles, China Space Lab, NASA Multi-Program Integratd Milestones, NASA. Assets: NASA Florida, Stars in ...
Datum: 21.01.2010 22:56 •
Größe: 27 MB
Rocketboom’s Ella Morton visits PBS Kids’ The Electric Company as they get ready to kick off their 2nd season on January 25th. Assets: The Electric Company Ch Words, starring bill cosby, Rita Moreno singing a song “Hey You Guys!”, Hey you guys original sketch, Bill Cosby Rita...
Datum: 20.01.2010 21:56 •
Größe: 48.2 MB
Rocketboom’s Humanwire correspondent Ruud Elmendorp reports on refugees in Berbera, Somalia.
Datum: 19.01.2010 16:35 •
Größe: 20 MB
In honor of A. A. Milne’s birthday Molly reports on the story behind the stories of Winnie the Pooh. Assets: Harry Colebourne and Winnie, Winnie Colebourn, Inspiration, Original Winnie the Pooh Toys, swan, a.a. milnes’ home, ashdown farm, milne and son and pooh, Christopher Robin and poo...
Datum: 18.01.2010 18:46 •
Größe: 29 MB
Molly visits the Lomography store in NYC and snaps a few shots around the city. Music by Podington Bear.
Datum: 16.01.2010 06:16 •
Größe: 49.2 MB
Rocketboom’s Ella Morton learns about ConEdison’s sponsored construction of the Harlem River Tunnel that will bring more electricity into Manhattan.
Datum: 14.01.2010 23:28 •
Größe: 46.9 MB
Molly reports on the recent earthquake in Haiti and what you can do to do help. Story links: Haiti, Haitian Creole, Port-au-Prince, About Haiti, Maps of earthquake, Geo search for tweets, Videos on YouTube of Haiti Earthquake, Twitpic Images of Haiti, Archipelago, Haitian Map. How you can help: Unic...
Datum: 14.01.2010 05:43 •
Größe: 24.9 MB
Molly reports on cryogenics, sea lions, and alternative energy. Story links: DMSO molecule, World’s Largest Solar Building, World’s Largest Solar Park, cell phone powered by soda, German solar cells, German solar cells II, Snowman Illustration, Preserved Brain, James Hiram Bedford Being ...
Datum: 12.01.2010 14:41 •
Größe: 22.1 MB
Molly reports on the day’s palindromes. Assets: reviver, nin, a-ha, abba, otto, montana, bob, ana, revilo p. oliver, mike kim, dirt wall, desserts, Miley Cyrus
Datum: 11.01.2010 20:09 •
Größe: 18.9 MB
Molly and Ellie meet up with Strala Yoga instructor Tara Stiles to learn a few key moves that relieve the stress and tension of a long day at the office.
Datum: 08.01.2010 13:42 •
Größe: 23.1 MB
Molly explains why yoga is worth trying in 2010. Assets: Yoga Energy Drawing, Woman Doing Yoga On Beach, Yoga Silhoette, Yoga Poses, Yoga Poses Number Two, Yoga Cat , Shiva Painting, Yoga Sillo Illustration, Hatha Yoga Poses, Screaming Cat Video, Time Yoga Article, Laughing And Dancing Video, Yogado...
Datum: 07.01.2010 15:26 •
Größe: 16.5 MB
Ella Morton interviews Main Squeeze Accordion Shop owner Walter Kuhr. Music from The Last of the International Playboys.
Datum: 06.01.2010 13:00 •
Größe: 57.4 MB
Apples and oranges (idiom), BMJ: Comparing apples and oranges: a randomised prospective study, Siamese twins (English language), CES 2010, Everything You Wanted to Know About the Google Nexus One, Major New Apple Product on January 27th?, The Future of Transportation Is Here: Electric Vehicles Go Ma...
Datum: 05.01.2010 13:00 •
Größe: 14.6 MB
wtfrthesealions, Cookie Monster Slayer, Search for Mars Polar Lander Still On, The Journal Geophysical Research Letters, Russia to Attack Astroid in 26 Years, Tuper Tario Tros game, Box Turns Itself Off When You Turn It On
Datum: 04.01.2010 17:56 •
Größe: 31.1 MB
The Suffersons, Episode 11 (final episode): Dana tells Josh her decision about whether she?s going to publish her memoir. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monda...
Datum: 01.01.2010 06:58 •
Größe: 8.9 MB
The Suffersons, Episode 10: Josh tries to bribe Dana not to publish her memoir. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monday, January 4th.
Datum: 01.01.2010 06:41 •
Größe: 8 MB
The Suffersons, Episode 9: Dana brings home an editor who wants to publish her memoir. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. Guest starring Joanne Colan. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monday, Jan...
Datum: 31.12.2009 14:15 •
Größe: 8.9 MB
The Suffersons, Episode 8: Having gone back to work as an accountant, Josh?s mother calls to congratulate him. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monday, January ...
Datum: 31.12.2009 13:52 •
Größe: 7.1 MB
The Suffersons, Episode 7: Josh finds out that Dana has written about his problematic testicle. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monday, January 4th.
Datum: 30.12.2009 14:09 •
Größe: 7.7 MB
The Suffersons, Episode 6: Josh and Dana agree to trade their in-progress work. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monday, January 4th.
Datum: 30.12.2009 13:24 •
Größe: 8.9 MB
The Suffersons, Episode 5: Josh and Dana discover that two writers in one small Brooklyn apartment can be very cramped. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monday,...
Datum: 29.12.2009 15:05 •
Größe: 14.1 MB
The Suffersons, Episode 4: Having found out that Josh?s novel is about their marriage, Dana decides she?s going to write a tell-all memoir on the very same subject. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the...
Datum: 29.12.2009 13:45 •
Größe: 4.9 MB
The Suffersons, Episode 3: Josh is interrupted in the middle of writing by a phone call from his mother. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monday, January 4th.
Datum: 28.12.2009 14:03 •
Größe: 9.1 MB
The Suffersons, Episode 2: Josh continues his pursuit of writing a novel even though his wife, Dana, mocks him. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monday, January...
Datum: 28.12.2009 13:45 •
Größe: 7.2 MB
The Suffersons, Episode 1: Having recently lost his job, Josh Sufferson decides he?s going to write a novel. Created by Blair Singer. Starring Michael Chernus and Susan Pourfar. For more information, see: The Rocketboom Blog. Mememolly and the Rocketboom Daily News will return on Monday, January 4t...
Datum: 28.12.2009 13:23 •
Größe: 10.7 MB
The most favorited episode of Know Your Meme for 2009 is Keyboard Cat! The Rocketboom Institute for Internet Studies presents its findings on Play Him Off Keyboard Cat, PHOKC blog, Lolcats, Lolrus, Furries and their Escalade!, charlie schmidt’s “cool cat”, Brad O’Farrell, Int...
Datum: 27.12.2009 02:22 •
Größe: 34 MB
‘Meme Week’ continues with the second most favorited Know Your Meme episode of 2009: Boxxy. FOAR EVERYWUN FRUM BOXXY, The Boxxy Story, How Boxxy brought the web to its knees, YouTube - boxxybabee’s Channel, Gaia Online, I Am Bored FOAR 4DD1 FRUM BOXXY, 4chan, Foar Everywun From Box...
Datum: 24.12.2009 23:20 •
Größe: 28.3 MB
?Meme Week? Day Three: the third most favorite Know Your Meme episode of 2009 was Auto Tune. The Rocketboom Institute for Internet Studies examines the phenomenon of Auto-Tune with help from special guest Professor “Weird Al” Yankovic! Antares Auto Tune, T-Pain: Can’t Believe It, N...
Datum: 23.12.2009 18:50 •
Größe: 65.2 MB
‘Meme Week’ Day Two, a look back at the favorite Know Your Meme episodes of 2009. Jamie Dubs of the Rocketboom Institute for Internet Studies investigates the Yo Dawg/Sup Dawg meme. For more on the history of internet memes and internet phenomena, visit KnowYourMeme.com. Pimp My Ride, Yo...
Datum: 22.12.2009 20:00 •
Größe: 23.4 MB
It’s the start of ‘Meme Week’, a look back at the favorite Know Your Meme episodes of 2009! Geddan quartet, Nico Nico Douga, Volume chaos GoldenEye 007, Goldeneye 007 - Gets down, strange mario 64 shindou edition glitch otherwise known as cartridge tilting, Super Mario Clouds, Carn...
Datum: 22.12.2009 00:00 •
Größe: 35.9 MB
The Rocketboom Institute for Internet Studies explains the phenomenon of om nom nom. Assets: Om Nom Montage, Nom Cake, cat bite dog, bizarre Nom, dog nom, caturday2, caturday3, caturday4, caturday53, omnom1, omnom2, omnom3, omnom4, omnom6, omnom5, omnom7, omnom bird, omnom8, Seasame Street Book Cove...
Datum: 18.12.2009 14:35 •
Größe: 29.2 MB
Rocketboom’s Ella Morton meets up with Surprise Industries in NYC to learn about the business of crafting surprises.
Datum: 17.12.2009 15:08 •
Größe: 34 MB
Rocketboom’s Humanwire correspondent Ruud Elmendorp reports on Iten, a city in Kenya which doubles in size during the winter because of an influx of international athletes training in the high altitude.
Datum: 16.12.2009 17:04 •
Größe: 30.4 MB
Molly reports on William Moulton Marston, creator of the lie detector test and of the comic book character Wonder Woman. Story links: Wonder Woman Jiggles Past In Slow Motion, Wonder Woman throws a karate guy, Wonder Woman Opening Theme Season 1, Assets: Polygraph , “Emotions of Normal People&...
Datum: 15.12.2009 17:30 •
Größe: 31.3 MB
Molly reports on uncontacted tribes. Story links: Helicopter Rescure, Bauxite, Amazon, Ayoreo, Ayoreo, Dongria, Dongria Kondh, Sentinelese, Sentinelese2, Last Pre Neolithic Tribe, Uncontacted Tribes, The Waiting Is the Hardest Part, John Frum, Tanna: John Frum, Cargo Cults of Tanna
Datum: 14.12.2009 14:51 •
Größe: 37.4 MB
Rocketboom’s Ella Morton interviews several 2010 Winter Olympic hopefuls to learn about their journey to earn a place in Vancouver. Extended interviews with each athlete available on our YouTube channel.
Datum: 12.12.2009 17:25 •
Größe: 73 MB
Molly interviews director Terry Gilliam and actress Lily Cole at the NYC premiere of The Imaginarium of Dr. Parnassus.
Datum: 10.12.2009 22:51 •
Größe: 61 MB
Rocketboom Tech’s Ellie Rountree speaks with Alvaro Fernandez, Founder of SharpBrains, to learn more about the neurology of our brains and cognitive training. Story links: Hippocampus, brain training, drivesharp Assets: transcranial magnetic stimulation, TMS, TMS 2, , Frontal Lobe
This episod...
Datum: 09.12.2009 16:46 •
Größe: 49.7 MB
Molly explains how Ricky Gervais launched the career of Karl Pilkington. Story links: Ricky on Letterman, Ricky Gervais and the Karl Pilkington Experiment, This Side of the Truth, Meet Karl Pilkington, Ricky Gervais Podcast - Sock Packing, Chimpanzee Karl, Monkey News: Cosmetic Monkey, Monkey News: ...
Datum: 08.12.2009 16:47 •
Größe: 16.2 MB
Molly informs us about various national food days. Story links: Cotton Candy : Collecting Cotton Candy, Chinese Cotton Candy, Cotton Candy Bot, Cotton candy extra Guinness - vattacukorextra Ungarn, cotton candy machine, Cotton Candy: The History of this Tasty Treat , Who Invented National Brownie D...
Datum: 07.12.2009 15:16 •
Größe: 15.1 MB
Paradox Week continues with Molly and the TV Show Paradox. Story links: Math - Bunker style,Shirley Meets Ritchy For the 1st Time, Mork Meets The Fonz, The Return Of The Six-Million-Dollar-Man & The Bionic Woman, Melrose Place - Crossover Kelly, New York and Queens S2:24, Crossovers and Spin Off...
Datum: 04.12.2009 19:05 •
Größe: 78 MB
It’s Paradox Week on Rocketboom. Today, Molly creates and explains Galileo’s Paradox.
Datum: 03.12.2009 20:35 •
Größe: 14.9 MB
It’s Paradox Week on Rocketboom. Today, Molly presents the Liar Paradox.
Datum: 02.12.2009 23:15 •
Größe: 1.9 MB
It’s Paradox Week on Rocketboom. Watch today’s episode on our YouTube channel to help Molly navigate through the Crocodile Paradox.
Datum: 01.12.2009 23:37 •
Größe: 4.7 MB
It’s Paradox Week on Rocketboom. Today, Molly explains the ontological paradox. Story links: Ontological Paradox, Quantum Leap: Thou Shalt Not, McFly & The Starlighters “Johnny B. Goode, Quantum Leap (TV Series), Slacker Assets: calendars, three iphones, nokia production 1&2, nok...
Datum: 30.11.2009 23:32 •
Größe: 24.4 MB
Molly explains Magma.
Datum: 28.11.2009 01:16 •
Größe: 59.4 MB
Rocketboom’s Jamie Dubs explains Thanksgiving memes and teaches us the Turkey Song. Happy Thanksgiving from all of us at Rocketboom!
Datum: 26.11.2009 19:04 •
Größe: 37.2 MB
Rocketboom’s Ella Morton meets up with Vendr.tv host Dan Delaney to get a few tips on street eats in New York City. Assets: Kliman, Mud, Schnitzel Truck, Street Sweets NY Truck, 53rd and 6th, Wafles & Dinges of Belgium, The Best Delicious Halal Gyro and Chicken, shellysblogger, Mister Soft...
Datum: 25.11.2009 20:42 •
Größe: 40.7 MB
Molly explains augmented reality. Story links: Thomas P. Caudell, Boeing, Boeing 737, calibration and evaluation, Man Showing Neo Geo Collection, Webcam, Mememolly, Nearest Tube Iphone App, Layar, Bionic Eye, Topps, Smart Grid, Augmented Reality Subway App, TAT Augmented Reality, 3D experience by Da...
Datum: 25.11.2009 00:06 •
Größe: 22.4 MB
Molly informs you about the not so successful success rate of art heists. Story links: Rare Works Stolen, Van Gogh Museum Assets: Miro, jail cell, The Scream, wall, boat, callonphone, sofa fort, couch fort, footprints, spike strip, mansion, Munich Art Museum, Security Car Crash, British Sting, Van G...
Datum: 23.11.2009 17:45 •
Größe: 29.6 MB
Molly explains the sweater curse. Story links: Rachel John, Extreme Knitting, 1000 Strand Knit, Art student knits life-size Ferrari, Mirian Tegels - the faster knitter in the world?, How to knit a sweater : Knitting a sweater: Increases in pattern, The Last Knit, Never Knit Your Man a Sweater (Unles...
Datum: 21.11.2009 07:30 •
Größe: 38.1 MB
The Rocketboom Institute for Internet Studies recounts the realtime web experience that was Balloon Boy. Story links:
Datum: 19.11.2009 13:37 •
Größe: 42.9 MB
Rocketboom’s Ella Morton interviews John Hillcoat, director of The Road, at the red carpet premiere in New York City.
Datum: 18.11.2009 15:45 •
Größe: 42.5 MB
Rocketboom Tech’s Ellie Rountree talks about generative music and interviews “laptop musician” Luke DuBois about his work in this medium. Story links: Generative Art, Luke DuBois Assets: Mozart, Golan Levin.
This episode was created in collaboration with Intel!
Datum: 17.11.2009 16:59 •
Größe: 33.6 MB
Molly gives the long and the short of the longest film title and the shortest film to date. Story links: NOTDOT Trailer, James Riffel, Night of the Day of the Dawn of the Son of the Bride of the Return of the Revenge of the Terror of the Attack of the Evil, Mutant, Alien, Flesh Eating, Hellbound, Zo...
Datum: 16.11.2009 11:39 •
Größe: 25.8 MB
Humanwire correspondent Ruud Elmendorp reports on the growing concern of malaria cases in Burkina Faso due to mosquitoes developing resistances to insecticides.
Datum: 13.11.2009 06:17 •
Größe: 26.3 MB
Molly uses Wikipedia to thread the story - keep it going by posting a video response! Story links: American Airlines Flight 587, Flight 587 Final Passenger List, Enrique Wilson, Gonzo’s Game Winning Hit, Luis Gonzalez, 2001 World Series, The Last Night of the Yankee Dynasty, 2001 Arizona Diamo...
Datum: 12.11.2009 14:21 •
Größe: 30 MB
Rocketboom field correspondent Ella Morton interviews Wikipedia founder Jimmy Wales at Ad-Tech NYC.
Datum: 12.11.2009 13:53 •
Größe: 42.9 MB
The Rocketboom Institute for Internet Studies examines the phenomenon of Auto-Tune with help from special guest Professor “Weird Al” Yankovic! Antares Auto Tune, T-Pain: Can’t Believe It, NPR.org: Auto Tune in Action (audio), Cher: Believe, T-Pain, T-Pain: Chopped and Skrewed, T-Pa...
Datum: 11.11.2009 12:06 •
Größe: 80.5 MB
Molly reports on duck faces, space hotels and more. Story links: Rene Descartes, Meditations on First Philosophy, Historic Tale Construction Site, Harbin, Heilongjiang, China, China plans for humanoid Olympics, MANOI GO ????????????????, Scientists ’cause’ Beijing snow, China Causes Snow...
Datum: 10.11.2009 09:40 •
Größe: 22.9 MB
Cookie Monster shows Ella the right way to eat a cookie - om nom nom nom nom! Rocketboom’s field correspondent Ella Morton heads over to Sesame Street in celebration of their 40th season to talk with a few furry inhabitants. Music by Podington Bear.
Datum: 09.11.2009 09:40 •
Größe: 47.6 MB
Elmo talks to Ella about grouches, Australia, and teaches her a new song! Rocketboom’s field correspondent Ella Morton heads over to Sesame Street in celebration of their 40th season to talk with a few furry inhabitants. Music by Podington Bear.
Datum: 09.11.2009 09:13 •
Größe: 37.8 MB
Abby Cadabby talks to Ella about being the new kid on the block and gives her some fairy advice. Rocketboom’s field correspondent Ella Morton heads over to Sesame Street in celebration of their 40th season to talk with a few furry inhabitants. Music by Podington Bear.
Datum: 09.11.2009 08:13 •
Größe: 36.7 MB
Cookie Monster, Elmo, and Abby Cadabby teach Ella a few dances moves. Rocketboom’s field correspondent Ella Morton heads over to Sesame Street in celebration of their 40th season to talk with a few furry inhabitants. Music by Podington Bear.
Datum: 09.11.2009 07:25 •
Größe: 14.1 MB
Molly raises awareness for recycling old technology. Story links: Computers, Electronics Recycling
Datum: 06.11.2009 15:14 •
Größe: 32.9 MB
Molly explains Guy Fawkes night better known as Bonfire Night. Story links: Fawkes Sketch, Guy Fawkes, Wired Sketch, Hanged, Drawn and Quartered, Execution of Guy Fawkes, Windsor Castle, Bonfire Night, Burn Me, Sparkler, Assets: Fireworks1, Fireworks2, Potatoes, Mulled Wine, Oranges, Toffee Apples, ...
Datum: 05.11.2009 16:24 •
Größe: 25.4 MB
Rocketboom Tech’s correspondent, Ellie Rountree, talks about the concept of Singularity and how it could potentially change the world. Story links: Moore’s Law, The Coming Superbrain, By 2040 you will be able to upload your brain…, Darwin’s Robots, Games Design Themselves, LI...
Datum: 04.11.2009 15:41 •
Größe: 24.5 MB
Molly reports on the latest in motorized chairs, polar ice caps, recycling, and more. Story links: La-Z-Boy, DWI in Motorized Chair, Motorized Lazyboy, Motorized La-Z-Boy, fun with motorized loveseat and recliner, Motorized Recliner, Aging to End in Manhattan, Life Extension Foundation, Run on Icela...
Datum: 03.11.2009 17:08 •
Größe: 33.7 MB
Story links: radiation symbol, radiation suit, moon, grains, department of environmental science, carl sagan, Luke Oman, Bakweri cocoyam farmer from Cameroon, Radiation Symbol, Level A Hazmat Suit, Arc Flash Suit Transformer, Moon Surface Craters, Pulses and Grains, Canned Goods, Canned Food, Bottle...
Datum: 02.11.2009 20:13 •
Größe: 35.2 MB
Molly, Ellie, Ella, and Leah take a road trip to the New Jersey Pine Barrens in search of the Jersey Devil (with a special guest.) Music by The Discoghosts
Datum: 31.10.2009 10:27 •
Größe: 80.2 MB
Bruawhahahahahahahaha!
Datum: 30.10.2009 04:12 •
Größe: 12.7 MB
Humanwire correspondent Mary C. Matthews gives us a glimpse into life of costume maker Serra Hirsch when she won Halloween NYC’s parade dressed as The Claw.
Datum: 29.10.2009 00:50 •
Größe: 43.8 MB
Today is the 105th anniversary of the first subway line opening in NYC.
Datum: 27.10.2009 15:52 •
Größe: 11.8 MB
Story links: Volunteers wanted for simulated 520-day Mars mission, Monorail Cat, Newsreader attacked by giant seagull, Howard Dean on Dr. Nancy - Giant bug crawls in background!, Internet, Twitter Blocked in China City After Ethnic Riot, Still No Internet or SMS Allowed in China’s Muslim Regio...
Datum: 26.10.2009 23:54 •
Größe: 23.9 MB
Molly visits some of the most picturesque landmarks in New York City.
Datum: 24.10.2009 20:50 •
Größe: 22.9 MB
Rocketboom Tech correspondent Ellie Rountree recommends 5 tips for installing Windows 7. Story links: Five Reasons Windows XP Has About a Year to Live, Windows 7 Packaging, Explore the possibilities of Dell and Windows 7, Windows 7 Icons, Dropbox, Dropbox, 8 ways to make use of dropio, Mozy, Free Ba...
Datum: 22.10.2009 18:57 •
Größe: 44.5 MB
Rocketbooms Humanwire correspondent Dr. Manjiri Prabhu reports on the difficult lives of left-handers and the association that promotes awareness in Pune, India.
Datum: 22.10.2009 04:11 •
Größe: 30.5 MB
Story links: Jupiter, Water, Desktop Black Hole, Bad Memories Written with Lasers, Moby-Dick to be rewritten with emoticons, Emoji Dick, 2010 Olympic Medals to be made from old circuit boards, Turning Flyer Boxes into Planters, When skyscrapers signal a downturn, Twitter credit card iPhone app is a ...
Datum: 20.10.2009 16:32 •
Größe: 16.1 MB
Story links: Balloon Boy, Playing Dead, Shepard Fairey Lied, TSA Agents Took My Son, Response to “TSA Agents Took My Son”, Nasa: world will not end in 2012, Institute for Human Continuity
Datum: 19.10.2009 13:48 •
Größe: 14.7 MB
Molly explores the weird world of status updates.
Datum: 17.10.2009 15:52 •
Größe: 8.2 MB
Rocketboom Tech correspondent Ellie Rountree explains how to optimize your Netbook. Story links: PC900 Comparison, MB1, Digital Pen Electronic Ink, News-Geek, Shocked Senior Man, Old Woman Using Laptop, Old Women with Laptop, Nerd 1, Parents Using Computer, Kids.
This episode was created in collabor...
Datum: 16.10.2009 00:15 •
Größe: 24.4 MB
Streetlamp, Frozen Female Body, Glass Harmonica, Lightning Rod, Kids Sharing, Evaporation, Oil and Water, Bifocals, Glass Music Glass Harp, Heat Conduction, Tokyo Summerland, Air Conditioners, Refrigerator, Charge Conservation, EZ Reacher, Transformers, Robot Arm, Sneeze, Hand Fins, Lead Poisoning, ...
Datum: 15.10.2009 15:40 •
Größe: 18.7 MB
Digital artist Borna Sammak displays his video art at a Best Buy in New York City.
Datum: 14.10.2009 19:25 •
Größe: 35 MB
Story links: Bear-4 HD Camera Flight, 1337arts Icarus Project TimeLapse Video (Max Altitude: 93,000 ft), Broadway Apple Store Flyover, Broadway store will feature unique roof design, high five new york city, Amplichoir, Carl Sagan - ‘A Glorious Dawn’ ft Stephen Hawking, Barack Obama̵...
Datum: 13.10.2009 14:12 •
Größe: 24.6 MB
Story links: NASA probe slams into the moon, LCROSS: IMPACT, Blasted into space from a giant air gun, Internet Eyes: Video Surveillance as Video Game, 10 Most Brilliant Innovators of 2009: X2 Coaxial Rotor Helicopter, 10 Most Brilliant Innovators of 2009: I-TEC?s Flying Dune Buggy, 10 Most Brilliant...
Datum: 12.10.2009 18:58 •
Größe: 17.8 MB
The Rocketboom Institute for Internet Studies explains the who, what, when, and why of ‘Where The Hell is Matt‘. Story links: Destroy All Humans - ps2 - Mission 01 Destination Earth!, Where The Hell is Matt — Interview with Matt Harding, Where the Hell WAS Matt?, Where the Hell is ...
Datum: 09.10.2009 19:02 •
Größe: 37.6 MB
Vampires Move to Top of Costumes List, The Halloween Store on Amazon, Trick-or-treat bags may be lighter this year, Global Economic Crisis Halloween Costume Ideas, iPod Costume, iPod Dog Costume, Land Line Phone Costume
Datum: 08.10.2009 20:30 •
Größe: 10 MB
Rocketboom field correspondent Ella Morton heads down to the Manhattan Bridge Centennial Parade to learn more about the bridge’s rich history. story links: Catherine and Cherry, Manhattan Bridge Photo, Brooklyn Pic, Life Magazine “Manhattan Bridge Under Construction”, Life Magazine...
Datum: 08.10.2009 00:01 •
Größe: 52.9 MB
Rocketboom’s Humanwire correspondent Allison Cross reports on the massive flooding problems faced by the people of Kroo Bay, Sierra Leone.
Datum: 07.10.2009 17:55 •
Größe: 52.1 MB
Rocketboom Tech correspondent Ellie Rountree talks about the advancement of home robots from 1982 to today. Story links: NYT: Planning Domesticated Robots, Android Amusement Corp, Boys and Robots Will Be Boys, Tomy Omnibot 5402 From 1984 in Action!, Omnibot 5402/TR5000 By Tomy, Talking Robie 2, Furb...
Datum: 06.10.2009 23:39 •
Größe: 33 MB
story links: Typhoon Ondoy, Markina River Raging By, Typhoon Ondoy September 26, 2009, MODIS Rapid Response System, Quake, tsunami near American Samoa kills at least 22, LA lifeguards clear beaches, Indonesians shaken and struggling after devastating earthquake, Officials: 3,000 People Trapped due t...
Datum: 06.10.2009 14:28 •
Größe: 27.5 MB
Expedition 21/Space Flight Participant Soyuz Docking to International Space Station, NASA’s LCROSS CRater Observation and Sensing Satellite, Human Population Calculator, List of countries by population, Lunar Reconnaissance Orbiter, Unfair Robot Fight, Original Winnie-the-Pooh Drawings, Kangar...
Datum: 05.10.2009 14:51 •
Größe: 23.4 MB
The Rocketboom Institute for Internet Studies gets down. Geddan quartet, Nico Nico Douga, Volume chaos GoldenEye 007, Goldeneye 007 - Gets down, strange mario 64 shindou edition glitch otherwise known as cartridge tilting, Super Mario Clouds, Carnival Chaos Geddan GoldenEye, Carnival Chaos Geddan Go...
Datum: 02.10.2009 15:08 •
Größe: 31.3 MB
Humanwire correspondent Valentina Canavesio reports on Luis Soriano Bohorquez who created the Biblioburro, or Library Donkey, in an effort to bring books and the gift of reading to the children in his community of La Gloria, Colombia.
Datum: 30.09.2009 21:55 •
Größe: 95.2 MB
Rocketboom’s Ella Morton meets up with Oxfam’s Human Countdown, President Obama, and the Yes Men during Climate Week NYC. Yes Men arrest footage provided by Brandon Jourdan.
Datum: 29.09.2009 21:18 •
Größe: 57.8 MB
story links: India’s mission to moon, India?s lunar mission finds evidence of water on the Moon, Moon Mineralogy Mapper…Reveal Water Molecules on Lunar Surface, Moon Water Found, Raises Questions About Origin Theory, Ice on Moon, No duh: Surgery success is not linked to phases of the moo...
Datum: 28.09.2009 21:01 •
Größe: 25.5 MB
You can’t get away from the internet.
Datum: 25.09.2009 21:26 •
Größe: 15.7 MB
Molly is ringside for the Futura vs Verdana IKEA Smackdown. story links: The Font War: Ikea Fans Fume over Verdana, IKEA 2009 Catalog, IKEA 2010 Catalog, Twitter Rants 1, 2, 3, 4, 5, 6, 7, 8, IKEA Petition, Stop IKEA going Verdana FB Group, Futura, Verdana, Paul Renner and Futura, Matthew Carter, Wi...
Datum: 25.09.2009 08:30 •
Größe: 22.7 MB
Humanwire correspondent Ruud Elmendorp reports on the adaptation of the XO laptop in Kenya.
Datum: 23.09.2009 21:44 •
Größe: 14.5 MB
Report: 35 million-plus worldwide have dementia, NASA launches rocket, dozens report strange lights, Rocket launch prompts calls of strange lights in sky, Black Brant, Milan Happy Clouds by Stuart Semple, Is Condensed Water the Salvation for Developing Countries?, DewPointe by AWS, Scanning Dead Sal...
Datum: 22.09.2009 14:18 •
Größe: 20.7 MB
Things Salesmen Hear, Most Likely Side for a Piece of Toast to Land, Pie I’ve Eaten, Jay Z, Scripting a PC, Planck First Light Yields Promising Results, Space Doesn’t Really Look Like That, Google Releases a Nuke, Google to Apple: You Lie, Apple Contradicts Google, Letter to FCC, Google ...
Datum: 21.09.2009 15:10 •
Größe: 21.9 MB
Molly is officially back at Rocketboom and is excited to report the daily news starting Monday! Send us your interesting and cool news stories at news@rocketboom.com
Datum: 18.09.2009 17:50 •
Größe: 14.4 MB
Rocketboom’s Humanwire correspondent Cheikh Seck reports on illegal immigration from Senegal to Spain. Story links: VOA, IOM
Datum: 16.09.2009 15:57 •
Größe: 39.6 MB
Rocketboom’s Ella Morton jumps aboard the “Half Moon“, a replica of the Dutch ship sailed by Henry Hudson in 1609. story links: New Netherlands, Henry Hudson, Half Moon 1, 2, 3, Amsterdam, Delaware Indians, Hudson River, music from Gounod.
Datum: 15.09.2009 15:23 •
Größe: 60.8 MB
Rocketboom’s Ellie Rountree checks out New York City’s Twestival held at Brooklyn Bowl, which raised money for local charity Camp Interactive. story links: Sound effects, Twestival screen captures 1, 2
Datum: 14.09.2009 22:06 •
Größe: 51.5 MB
Rocketboom captures moments from this morning’s September 11th commemoration at Zuccotti Park near the World Trade Center site in New York City.
Datum: 12.09.2009 03:39 •
Größe: 37.1 MB
Rocketboom’s Ella Morton tours the Waterpod, a sustainable eco-barge floating around NYC.
Datum: 10.09.2009 17:39 •
Größe: 67.6 MB
Rocketboom Field Correspondent Ruud Elmendorp reports on solar powered cell phones being sold in Kenya.
Datum: 09.09.2009 22:22 •
Größe: 16 MB
Rocketboom Tech’s Ellie Rountree talks about the best Bond gadgets from the last 50 years.
This episode was created in collaboration with Intel!
“Blue Pi” by Digital Juice, wires, BMW 750i, boombox, ericsson, FCC, 1984 cell phone, safecracker, lockmasters, laser induced, ionatron...
Datum: 09.09.2009 03:27 •
Größe: 29.3 MB
Rocketboom’s field correspondent Ella Morton discovers the dangers of window washing. Niagara Falls In A Raft , Simons Windows, one seats,
Datum: 07.09.2009 16:48 •
Größe: 42.3 MB
The Rocketboom Institute for Internet Studies explores the meme of David After Dentist.David After Dentist, Itstheinterweb, Stonerforums, MrkNchls, Electric Method Remix, Animated, David After the Divorce, David After Drugs, Flippy After David After Dentist, Chad After Dentist, Blog, Sun Times, Kids...
Datum: 04.09.2009 13:21 •
Größe: 39.4 MB
A Rocketboom Encore presentation. adam quirk and wreck & salvage adapt franz kafka?s metamorphosis
Datum: 03.09.2009 18:10 •
Größe: 11.4 MB
Rocketboom Field Correspondent Ruud Elmendorp explores the new Swahili video game that encourages slum survival skills in Kenya.
Datum: 02.09.2009 15:51 •
Größe: 22.5 MB
Molly talks about turning digital things into tangible art.
Datum: 01.09.2009 13:55 •
Größe: 13 MB
Rocketboom Tech correspondent Ellie Rountree visits engineer and founder of Adafruit Industries, Limor Fried, to talk about their DIY open source electronic kits.
This episode was created in collaboration with Intel!
Datum: 31.08.2009 15:36 •
Größe: 52.1 MB
A Rocketboom Encore Presentation. Miniature City. Inspired by Little People. Music by Drew.
Datum: 30.08.2009 00:54 •
Größe: 27.2 MB
Rocketboom NYC field correspondent, Ella Morton, meets up with a few New York based traceurs to learn about the art and physicality of Parkour. Jump Britain.
Datum: 27.08.2009 15:14 •
Größe: 63.9 MB
Rocketboom NYC field correspondent, Ella Morton, climbs beneath Atlantic Avenue in Brooklyn, NY to learn more about the folklore and discovery of this uncovered tunnel from the late 1800s. History of New York, Tunnel Photos, Brooklyn Rail, John Wilkes Booth
Datum: 26.08.2009 19:06 •
Größe: 28.3 MB
Rocketboom Spotlight: New York Airplane Flight by Sam Fuller.
Datum: 25.08.2009 22:24 •
Größe: 16.8 MB
Molly has just been officially approved to work in the U.S. and will be back in New York City soon to begin anchoring Rocketboom daily! Welcome aboard Molly!
Datum: 25.08.2009 02:42 •
Größe: 2.7 MB
Rocketboom NYC Correspondent Ella Morton interviews the creators of I Can Has Cheezburger The MusicLOL.
Datum: 22.08.2009 06:20 •
Größe: 67.9 MB
Rocketboom Tech correspondent Ellie Rountree tells you about 8 applications you should try. Vuze (PC or Mac), Fluid (Mac), Spotify PC or Mac), Airfoil (PC or Mac), Readability (PC or Mac), Caffeine (Mac), Awaken (Mac), Write Room (Mac)
This episode was created in collaboration with Intel!
Datum: 20.08.2009 03:10 •
Größe: 23.6 MB
The Rocketboom Institute for Internet Studies investigates why the whistles go whoo whoo with Bubb Rubb. Links to all your Bubb Rubb resources matt-d, Ghost Ride It, Gas Break Dip, Kron.com, archive.org, socalevo.net, whistle tips, Bubb Rubb everywhere, Bubb Rubb sound board, whistle tips banned, Bl...
Datum: 18.08.2009 21:07 •
Größe: 44.9 MB
Rocketboom NYC correspondent Ella Morton explores New York City’s Summer Streets program.
Datum: 17.08.2009 06:24 •
Größe: 42.9 MB
Rocketboom Tech correspondent Ellie Rountree tests out a new application from the UK-based company, Across Air, called Nearest Subway and interviews Managing Director Chetan Damani.
This episode was created in collaboration with Intel!
Datum: 14.08.2009 01:33 •
Größe: 107.9 MB
Humanwire field correspondent Cheikh Seck in Senegal speaks with world renowned artist, Mamadou Tall Diedhiou about his recycled bird statues.
Datum: 12.08.2009 20:55 •
Größe: 57 MB
Rocketboom NYC Correspondent Ella Morton meets up with Manhattan Borough Historian, Michael Miscione, to talk about the changing landscapes of New York City.
Datum: 12.08.2009 03:00 •
Größe: 62.6 MB
Rocketboom NYC Correspondent Ella Morton speaks with founder Patty Heffley and singer Elizabeth Soychak of the Renegade Cabaret on the High Line, a non-sanctioned musical performance that takes place nightly next to the High Line Park in the Chelsea neighborhood of New York City.
Datum: 10.08.2009 20:45 •
Größe: 57.7 MB
The Rocketboom Institute for Internet Studies presents their findings on the awkwardness that is Weegee. Mario is Missing, game footage from Mario is Missing, Software Toolworks, Super Mario Bros. (film), Mr T Ate My Balls, Creepy Chan, The Hasslehoff Image Database, Carlton Banks, Chuck Norris Fact...
Datum: 07.08.2009 15:00 •
Größe: 35.5 MB
Rocketboom NYC Correspondent Ella Morton interviews artist Josh Hadar about his hand sculpted custom bicycles.
Datum: 06.08.2009 18:33 •
Größe: 52.7 MB
Rocketboom Field Correspondent Ruud Elmendorp reports on the closing of the Fluorspar Mine in Kenya as a result of the global credit crisis.
Datum: 05.08.2009 16:00 •
Größe: 34 MB
Rocketboom Tech correspondent Ellie Rountree speaks with artist and programmer Zach Lieberman about his work on interactive art including openFrameworks, computer vision and the creation of the Toyota IQ font.
This episode was created in collaboration with Intel!
Datum: 04.08.2009 13:30 •
Größe: 50.6 MB
Rocketboom NYC Correspondent Ella Morton interviews Ryan Mackey and Andrew Turteltaub of Break Out in Song, a series of flashmob musicals staged on the streets of New York City.
Datum: 03.08.2009 13:30 •
Größe: 73.4 MB
The Rocketboom Institute for Internet Studies explores the couture sensation that is Three Wolf Moon. Three Wolf Moon T-Shirt, The Mountain, Antonia Neshev, Power Animals, Amazon.com: Profile for B. Govern, Three Wolf Moon (musical), T-Shirt Becomes Overnight Internet Sensation, Joke review boosts T...
Datum: 31.07.2009 22:00 •
Größe: 39.5 MB
An update from Molly. London Aquarium, Jumping through trees!, Top Gear star to build Lego house, Antony Gormley, One & Other, Trafalgar Square plinth becomes surprise web hit for Sky Arts, ‘Space Cheese’ tumbles back to High Wycombe!
Datum: 31.07.2009 00:00 •
Größe: 6.9 MB
Rocketboom NYC Correspondent Ella Morton visits the ConEd Steam Plant to find out more about the New York City Steam System.
Datum: 30.07.2009 05:56 •
Größe: 29.9 MB
Las Vegas, Nevada, Tour of Las Vegas (pdf), New York City Sees Slide in Tourism , Tourism mecca Orlando sweats sour economy, Pinching pennies in Hollywood, Mortgage defaults high in Nevada, Foreclosures jump 57% in March, Nevada?s jobless rate hits 11.3 percent, Metropolitan Area Employment and Unem...
Datum: 28.07.2009 12:28 •
Größe: 19.3 MB
World’s Second Largest Aquarium, Georgia Aquarium, Check This Out: Movie Monsters Size Comparison Chart, Dune (film), Shai Hulud, International Space Station Pass Chart, How Big Is the ISS Compared to Science Fiction Spaceships?, 50 Billion Suns! -The Biggest Single Object in the Universe -A G...
Datum: 27.07.2009 16:35 •
Größe: 21.6 MB
Painting with Light.
Datum: 25.07.2009 02:00 •
Größe: 7.6 MB
The American Meteorological Society, Climate engineering research gets green light, Rich Harvard, Poor Harvard, Time.com Poll: Now that Walter Cronkite has passed on, who is America’s most trusted newscaster?, Online Poll: Jon Stewart Is America’s Most Trusted Newsman, Auto-Tune the News...
Datum: 23.07.2009 14:11 •
Größe: 19.4 MB
Pair with same first, last name to wed, How to Go to Mars–Right Now!, China and Russia to Mars, $18M Being Spent to Redesign Recovery.gov website, NYPD spends neary $1M on Typewriters, July eclipse is best chance to look for gravity anomaly , The Sims 3, Gundam 30th Anniversary, Gundam RX-78-2...
Datum: 21.07.2009 10:00 •
Größe: 17.5 MB
Salem Witch Trials, Henry Allingham: World’s Oldest Man Dies At 113, Henry Allingham image, Family Tree 1, 2, Flag of the United Kingdom, Walter Breuning, Great Falls, Montana, The Fall Guy, Caught on Tape! Goo Invades Alaskan Waters , or WTF Is That!?: 12-Mile Biological Goo In Arctic, Uniden...
Datum: 20.07.2009 05:30 •
Größe: 22.2 MB
A song for the last four telephone booths in Manhattan by Molly.
Datum: 17.07.2009 23:15 •
Größe: 20.8 MB
Rocketboom Tech correspondent Ellie Rountree interviews Scott Beale of Laughing Squid, one of the oldest independently owned and operated web hosts in San Francisco. Music by Podington Bear.
This episode was created in collaboration with Intel!
Datum: 17.07.2009 20:00 •
Größe: 7 MB
Apollo 11, Mission Commander Neil Alden Armstrong, Lunar Module Pilot Edwin Eugene ‘Buzz’ Aldrin, Jr., Michael Collins, Command Module Pilot, Jethro Tull, Benefit (album), Beef Posters, Know Your Meme: Vince Shlomi (ShamWow, Slap Chop) (2008), My Sunshine by Nikola Uzunovski, Space Stati...
Datum: 16.07.2009 18:00 •
Größe: 23.5 MB
Rocketboom NYC Correspondent Ella Morton talks to World Champion Competitive Eater Tim Janus, a.k.a. “Eater X” of the International Federation of Competitive Eating
Datum: 15.07.2009 15:16 •
Größe: 10.1 MB
Unimate, robot assembly line, Boston Dynamics Big Dog, Dustbot, Cell Phones That Listen and Learn, Computer learns sign language by watching TV, How To Insult Someone Using British Sign Language, MIT developing fabrics capable of taking pictures, Gundam over Tokyo
Datum: 14.07.2009 04:01 •
Größe: 23.1 MB
Pope John III, Breakdancing for the Pope, Gene Tests Confirm Identity, Possible Eye Color of Copernicus, Extreme alarm clock, I try to put on a happy face, Interplanetary internet gets permanent home in space , New Salamander Discovered Near Georgia Busy Road
Datum: 13.07.2009 12:00 •
Größe: 24.4 MB
July 12, 2009 Manhattanhenge, when the sun sets in alignment with the buildings of New York City. Manhattanhenge and the Real-Time Moment, Hayden Planetarium: Manhattanhenge
Datum: 13.07.2009 06:25 •
Größe: 7.6 MB
Commodore 64, The TI-99/4A Home Computer Page, squat part 2 ?????????????????, CERN - The Large Hadron Collider, Large Hadron Rap
Datum: 10.07.2009 02:00 •
Größe: 25 MB
Rocketboom Tech correspondent Ellie Rountree talks to artists Jeff Crouse and Aaron Meyers about their augmented reality game, The World Series of Tubing.
This episode was created in collaboration with Intel!
Datum: 09.07.2009 14:00 •
Größe: 34.6 MB
The Rocketboom Institute for Internet Studies presents its findings on Play Him Off Keyboard Cat, PHOKC blog, Lolcats, Lolrus, Furries and their Escalade!, charlie schmidt’s “cool cat”, Brad O’Farrell, Interview with Brad O’Farrell on Rocketboom, Play Haley Off, Keyboar...
Datum: 08.07.2009 12:00 •
Größe: 31 MB
Rocketboom Field Correspondent Ruud Elmendorp reports on the recent ban on the importation and exportation of scrap metal in Kenya.
Datum: 07.07.2009 21:00 •
Größe: 29.2 MB
Jan Hus, Hussitism and the heritage of Jan Hus, Hawking Says Humans Have Entered a New Stage of Evolution, (via Slashdot), Facebook group results for ‘Stephen Hawking’, HOW MUCH INFORMATION 2003?, The Sims 3, Rocketboom Field Correspondent Ella Morton, Rocketboom LA Talent Search, Twitte...
Datum: 06.07.2009 21:15 •
Größe: 28.8 MB
Hi Molly! (Molly’s Blog, Molly on Twitter, Molly on YouTube)
Datum: 06.07.2009 21:00 •
Größe: 35.5 MB
Rocketboom spotlight: Iran: A nation of bloggers by Aaron Chiesa, Toru Kageyama, Hendy Sukarya, and Lisa Temes, students the Vancouver Film School.
Datum: 03.07.2009 19:20 •
Größe: 13.5 MB
Rocketboom Field Correspondent Ruud Elmendorp reports on Iko Toilets (translation: “There Is A Toilet”) in Kenya.
Datum: 01.07.2009 12:00 •
Größe: 27.8 MB
Rocketboom Tech correspondent Ellie Rountree attends Research@Intel Day in Mountain View, CA.
This episode was created in collaboration with Intel!
Datum: 29.06.2009 16:00 •
Größe: 36.2 MB
Rocketboom Tech correspondent Ellie Rountree explores the Computer History Museum in Mountain View, CA.
This episode was created in collaboration with Intel!
Datum: 25.06.2009 15:00 •
Größe: 78.7 MB
Rocketboom Field Correspondent Cheikh Darou Seck reports on plastic recycling in Senegal.
Datum: 16.06.2009 21:45 •
Größe: 84.3 MB
Rocketboom Tech correspondent Ellie Rountree visits the first Consumer Genetics Show in Boston, MA. Extra: Ellie interviews molecular geneticist George Church.
This episode was created in collaboration with Intel!
Datum: 15.06.2009 23:40 •
Größe: 44.4 MB
Rocketboom Spotlight: Fantasmagorie by Émile Cohl, widely considered to be the first fully animated film ever made.
Datum: 12.06.2009 19:18 •
Größe: 9.2 MB
Rocketboom Field Correspondent Ruud Elmendorp continues his report on The African Union Mission to Somalia (AMISOM) peacekeeping mission in Mogadishu, Somalia. Watch Part 1 here.
Datum: 10.06.2009 14:00 •
Größe: 41.9 MB
Rocketboom Tech correspondent Ellie Rountree speaks with Dr. Carl Dietrich, co-founder of Terrafugia, creators of the Transition flying car (or ‘roadable aircraft‘) at the 2009 Greenwich Concours d’Elegance.
This episode was created in collaboration with Intel!
Datum: 09.06.2009 05:00 •
Größe: 61.5 MB
From 2005: then Rocketboom field correspondent Zadi Diaz interviewed Current TV journalist Laura Ling. This past weekend, Laura Ling and fellow journalist Euna Lee were sentenced to 12 years in a North Korean hard labor camp for attempting to report on Korean refugees along the North Korea-China bor...
Datum: 08.06.2009 17:00 •
Größe: 15.7 MB
Rocketboom Tech correspondent Ellie Rountree takes a look at the soon to be released Palm Pre. Extras #1, #2.
This episode was created in collaboration with Intel!
Datum: 06.06.2009 06:25 •
Größe: 19.8 MB
talentsearch.rocketboom.com
Datum: 03.06.2009 16:00 •
Größe: 14.7 MB
Rocketboom Field Correspondent Ruud Elmendorp reports on The African Union Mission to Somalia (AMISOM) peacekeeping mission in Mogadishu, Somalia.
Datum: 02.06.2009 16:41 •
Größe: 33.5 MB
Rocketboom Spotlight: ‘Sorry I’m Late‘ by Tomas Mankovsky.
Datum: 29.05.2009 12:00 •
Größe: 53 MB
The Rocketboom Institute for Internet Studies considers the history of Allison Harvard (aka Creepy Chan) a contestant on America’s Next Top Model. Allison on Flickr, Allison on DeviantArt, Allison on MySpace, The Creepiest People on MySpace, Creepy Chan on America’s Next Top Model, Allis...
Datum: 28.05.2009 12:00 •
Größe: 16.4 MB
Rocketboom field correspondent Chuck Olsen interviews Bruce Sterling on the concept of Spimes
Datum: 27.05.2009 17:00 •
Größe: 32.7 MB
Rocketboom Tech correspondent Ellie Rountree shows us some of her favorite productivity applications. Tweetdeck, CoTweet, Adium, Sizzling Keys, Dropbox, Drop.io, Download Helper, Snapz Pro X, Aviary, Quicksilver, Little Snitch. Music by Podington Bear
This episode was created in collaboration wit...
Datum: 26.05.2009 15:00 •
Größe: 36.9 MB
Ellie Rountree interviews Brad O’Farrell creator of ‘Play him off, keyboard cat’. Keyboard Cat on CNN, Keyboard Cat on Time.com, Keyboard Cat on Urlesque, Charlie O’Donnell. Music by Podington Bear.
Datum: 15.05.2009 23:45 •
Größe: 69.3 MB
C64.com, NASA To Give Hubble New Life With Atlantis Mission Launching Today, Hubble Space Telescope, ESA to launch two large observatories to look deep into space and time, ESA: Herschel, ESA: Planck, Save The Pacific Northwest Tree Octopus, United States Patent Application: 0060071122 - Full body t...
Datum: 12.05.2009 18:00 •
Größe: 36.6 MB
Peanut Butter Jelly Time [original Flash version], Peanut Butter Jelly Time [YouTube video], PBJT on Newgrounds.com, PBJT on Family Guy,It’s Peanut Butter Federline!!!, Peanut Butter Jelly Time - Banana Man, or Peanut Butter Jelly Time at the Rays game, Offtopic.com, Buckwheat Boyz, Buckwheat ...
Datum: 09.05.2009 01:00 •
Größe: 56.6 MB
Rocketboom Tech correspondent Ellie Rountree talks to Adam Harvey and Anaid Gomez of the Interactive Telecommunications Program at New York University about Wearable Technology.
This episode was created in collaboration with Intel!
Datum: 07.05.2009 06:19 •
Größe: 53 MB
Rocketboom interviews Jordan Seiler about his Public Ad Campaign replacing 120 illegal NPA Outdoor billboards with art in New York City. Related Episode: Brand Jacking and Subvertising. (Thanks to Ronen!)
Datum: 05.05.2009 19:00 •
Größe: 26.2 MB
Number of Pirates Killed by Obama In Two Graphs, Marines’ Hymn [mp3], America and the Barbary Pirates: An International Battle Against an Unconventional Foe, First Barbary War, Google: Mowing with goats, Raindrops splash before they hit the ground, Shreyas Mandre, MIT piano drop Spring 2009 b...
Datum: 04.05.2009 20:00 •
Größe: 25.9 MB
The Universal Records Database, Most Images Of ‘Uncle Jesse’ Viewed On A Web Browser At Once, 54 images of Uncle Jesse, Most Tweets Sent To MC Hammer In One Minute Using Cell Phone, Most Pieces Of Tape Taped To Face At Once, Most Playing Cards Incorrectly Guessed In A Row, Most Times Say...
Datum: 01.05.2009 09:00 •
Größe: 32.7 MB
Rocketboom Field Correspondent Ruud Elmendorp reports on a local, Nairobi, Kenya-based effort to recycle plastic bags into fencing poles.
Datum: 30.04.2009 04:16 •
Größe: 84.5 MB
Did NASA shoop an image of the Space Shuttle? Does it really matter? NASA faked Shuttle picture!, Discover Blogs: NASA FAKED A SHUTTLE IMAGE!!!!!
Datum: 29.04.2009 17:00 •
Größe: 5.7 MB
There’s been only one US President to order an attack against pirates? Seriously?
Datum: 29.04.2009 00:00 •
Größe: 1.6 MB
Rocketboom Tech correspondent Ellie Rountree talks with Philip Rosedale, founder of Linden Lab and creator of Second Life.
This episode was created in collaboration with Intel!
Datum: 27.04.2009 05:00 •
Größe: 29.5 MB
The Rocketboom Institute for Internet Studies presents its findings on Single Serving Sites — websites that serve a single purpose, presenting a single piece of information. Jason Kottke: Single Serving Sites, Ryan Greenberg, Is This Your Paper On Single Serving Sites dot com, Tired.com, Purp...
Datum: 23.04.2009 21:00 •
Größe: 30.5 MB
Rocketboom Tech correspondent Ellie Rountree visits the Intel WiMax Labs in Hillsboro, Oregon to take a more in-depth look at the next generation of mobile high-speed internet connectivity. Related coverage: What Is WiMax?
This episode was created in collaboration with Intel!
Datum: 22.04.2009 21:00 •
Größe: 46 MB
Grounation Day, Haile Selassie (video), Hernan Cortes Arrives, LOL Jesus, God on Facebook, Facebook profile market, Crisscrossing the Earth with subterranean tunnels at ballistic missile speeds (via), The Deepest Hole, The Integrated Ocean Drilling Program
Datum: 21.04.2009 17:00 •
Größe: 37 MB
Welcome to Caitlin Hill, Caitlin on YouTube, Caitlin on Twitter. Pluto, Clyde Tombaugh, Harvard College Observatory, The girl who named a planet , Pluto (Disney Character) History, International Astronomical Union, Clearing the neighbourhood, Illinois: Pluto Is a Planet, New Mexico Legislature: Decl...
Datum: 20.04.2009 04:00 •
Größe: 49.5 MB
Thank you, Joanne!
Datum: 17.04.2009 19:00 •
Größe: 50.9 MB
Does Big Corporate Media affect the lulz? The Rocketboom Institute for Internet Studies presents a case study on the Christian Bale Rant/Freak Out. ‘Bale Went Ballistic’, Britney Rages, Kanye West’s Tirade, Rageguy, Angry German Kid, BaleOut Remix, Christian Bale vs Dora the Explor...
Datum: 16.04.2009 16:00 •
Größe: 24.4 MB
Jamie Dubs of the Rocketboom Institute for Internet Studies investigates the Yo Dawg/Sup Dawg meme. For more on the history of internet memes and internet phenomena, visit KnowYourMeme.com. Pimp My Ride, Yo Dawg entry in the MemeDB, Yo Dawg Macros, Yo Dawg We Herd U Liek Tumblr, Let them eat cake, M...
Datum: 13.04.2009 06:00 •
Größe: 31.8 MB
Rocketboom Tech correspondent Ellie Rountree talks to Bre Pettis, and Zach Hoeken about their new company, MakerBot Industries, building open source robot kits that allow you to do rapid prototyping and 3D Printing at home. Music: Can Opener by The Discoghosts. Rocketboom Extra: Ellie and the Flami...
Datum: 08.04.2009 13:00 •
Größe: 49 MB
Rocketboom Tech correspondent Ellie Rountree visits NYC Resistor, a hacker collective in Brooklyn, NY. Links: Bre Pettis, DIY Freaks Flock to ‘Hacker Spaces’ Worldwide, Hackerbot Labs, Chaos Computer Club, Hackerspaces.org This episode was created in collaboration with Intel!
Datum: 07.04.2009 05:00 •
Größe: 41.4 MB
The 2009 NYC Pillow Fight held on Wall Street in New York City. Music: Revolve by hisboyelroy. Also see Rocketboom coverage of the 2008, 2007, and 2006 Pillow Fights.
Datum: 06.04.2009 06:00 •
Größe: 39.5 MB
If time was infinite and space was finite everything would repeat.
Datum: 03.04.2009 15:00 •
Größe: 16.2 MB
New York City 1911-Present, by Adam Quirk of Wreck and Salvage, NYPL Digital Gallery, video of the Empire State Building, music by Dosh
Datum: 02.04.2009 18:00 •
Größe: 42.5 MB
The Rocketboom Institute for Internet Studies investigates ‘Numa Numa,’ a classic meme in Internet History. Numa Numa, Gary Brolsma, O-Zone - Dragostea Din Tei, Rocketboom Interview with Gary ‘Numa Numa’ Brolsma, Numa Numa voted #1 by VH1, Dragostea Din Tei on The Today Show,...
Datum: 31.03.2009 10:00 •
Größe: 29.5 MB
Rocketboom visits a ‘World Record Appreciation Society’ event in New York City, an open, participatory evening of world record setting organized by the creators of the Universal Records Database.
Datum: 30.03.2009 14:00 •
Größe: 53.2 MB
Rocketboom Spotlight: Slagsmålsklubben - Sponsored by destiny. A reinterpretation of the fairytale Little Red Riding Hood. Motion graphics by Tomas Nilsson, music: Slagsmålsklubben
Datum: 27.03.2009 18:00 •
Größe: 15.2 MB
Rocketboom Field Correspondent Ruud Elmendorp investigates the rise in boda bodas (or motorcycle taxis) in Kenya.
Datum: 26.03.2009 19:00 •
Größe: 51.8 MB
Internet Scientists Jamiedubs, Elspethjane, and Yatta host a live Know Your Meme internet meme trivia show at the O’Reilly IgniteNYC3 event in New York City. Contestants include Rex Sorgatz, Gavin Purcell, Peter Rojas, Nate Westheimer, Kelly Reeves, Michelle DeForest, Tim Shey, Caroline McCart...
Datum: 25.03.2009 18:00 •
Größe: 66.5 MB
story links: rocketboom on twitter, bbq, discardia, hair cut, brain diseases, cisco 7940g, working, incredible horse stunt, weather, mario brothers line rider, escalator skiing, awkward moments on tape, ordering toner, peanuts, robogeek
Datum: 24.03.2009 13:00 •
Größe: 24.8 MB
Rocketboom Tech field correspondent Ellie Rountree asks SXSW attendees what’s in their gadget bags. This episode was created in collaboration with Intel!
Datum: 23.03.2009 00:00 •
Größe: 76.2 MB
Director Ben Steinbauer and ‘Winnebago Man’ Jack Rebney speak at the 2009 SXSW Interactive Festival in Austin, TX. Winnebago Man documentary. Original Winnebago Man video. Music by Podington Bear.
Datum: 21.03.2009 01:45 •
Größe: 24.1 MB
Rocketboom Spotlight:Obama’s Message to Iran.
Datum: 19.03.2009 20:00 •
Größe: 28.4 MB
Rocketboom Spotlight: ‘a micrometer from here’ by Amit Zakai
Datum: 18.03.2009 16:00 •
Größe: 24.6 MB
Dubai, United Arab Emirates, Persian Gulf, Arabian Peninsula, Dubai Financial Services Authority, Abu Dhabi, World’s Richest City Wants to Be Culture Capital of Arab World, The outstretched palm (Abu Dhabi bails out its neighbour), Dubai’s six-year building boom grinds to halt as financi...
Datum: 17.03.2009 06:45 •
Größe: 22.4 MB
Chimp’s stone throwing at zoo visitors was ‘premeditated’, A Comeback for Lamarckian Evolution?, The Cones Project, Sorry, this space is taken , Illinois plutocrats are frakkin? goofy, Benoit Lemoine’s Zipper Tape, The International Space Station to become the second brightes...
Datum: 16.03.2009 09:00 •
Größe: 18.7 MB
Rocketboom Tech field correspondent Ellie Rountree visits the Intel Science Talent Search in Washington D.C. Society for Science & The Public, STS 2009 Winners
Datum: 14.03.2009 13:00 •
Größe: 48 MB
Rocketboom Spotlight: “The Collector”, by John Douglas Powers
Datum: 13.03.2009 13:00 •
Größe: 27.3 MB
Novel electric signals in plants, Face of the Bard comes to life, S.F. may crack down on ‘flash mob’ antics, French town of Eu to change name because of Google searches, Marie Francoise Gaouyer, The Making of The Petaminx, America becoming less Christian, survey finds, The Mime on Twitte...
Datum: 12.03.2009 13:00 •
Größe: 10.4 MB
Rocketboom Field Correspondent Ruud Elmendorp interviews Julius Kasyoka, a reporter of Cameras for Kibera. A Dutch project from the Hot Sun Foundation that gives young Kenyans the tools to be citizen journalists.
Datum: 11.03.2009 14:00 •
Größe: 53.3 MB
NASDAQ, the Dot Com Bubble, the 401keg Plan, YouTube ADDICT, COPS for Kids!, The Beatles, Popular Music and Society* (MA), The Beatles Last Concert, Blame Ringo - Garble Arch (A Day in the Life of Abbey Road), Welcome to the new gold mines
Datum: 10.03.2009 13:00 •
Größe: 18.5 MB
Who’s afraid of the big bad Tweets? Perhaps Google? Goocam World Map, Town Square, Shake Shack, Waiting in line at Shake Shack. Moving surprisingly slow., Google CEO: Twitter A ‘Poor Man’s Email System’, Google Blog Search Results for ‘Watchmen’, Twitter Search Re...
Datum: 09.03.2009 13:30 •
Größe: 20.2 MB
Joanne battles her nemesis.
Datum: 06.03.2009 19:00 •
Größe: 27.2 MB
Azumi and David Sunglasses, Drink Up, Energy Hogs, In bad times, seed sales grow, Street signs for Mullet Place keep disappearing, backyard mullet, Megamullet, A Boy, His Balloon & His Mullet, bundesliga, Porn in the USA: Conservatives are biggest consumers, Red states consume more porn?, Red Li...
Datum: 05.03.2009 14:10 •
Größe: 8.8 MB
Facebook and Bebo risk ‘infantilising’ the human mind, Susan Greenfield, Graph: Internet Population Distributio, The Golden Week has begun, Ladies and Gentlemen, , The world’s largest online social network: QZone, Safari 4 benchmarked: 42x faster than IE 7, 3.5x faster than Firefox...
Datum: 04.03.2009 16:00 •
Größe: 14.3 MB
Alive In Baghdad interviews Hassan Fadhel Allah al-Hussaini, the editor of Rayat al-Arab newspaper in Baghdad. He offers a personal perspective on the wide variety of dangers facing journalists in Iraq.
Datum: 02.03.2009 14:00 •
Größe: 40.9 MB
The Sun Newspaper, 04/12/08, ROCKETS Magazine, Vince with Slap Chop (Long version), Candy ad, Rejoice Comb Ad, Clever Yoga Ad, Kill Bill ad, Ballet school ad, Butt Jobs ad, 40 Advertisements that Grab your Attention, Light Criticism by Steve Lambert, Light Criticism on Rocketboom, The Bubble Proj...
Datum: 26.02.2009 15:00 •
Größe: 27.1 MB
Rocketboom Spotlight: Tomt and I by Daz Spencer Lovesey and Joe Barcham. Produced by: Go Forward Films and Dave Lankester.
Datum: 25.02.2009 16:00 •
Größe: 18.1 MB
Cuba Switching to Linux, Global PC Sales Fall, First Time In Six Years, Why netbooks are killing Microsoft, Han Solo in Carbonite, no, it’s Guacamole!, He’s no guac to me dead, US Becomes Top Wind Producer; Solar Next, Report: Nearly 75% of ex-Bush officials looking for jobs are unemplo...
Datum: 24.02.2009 16:00 •
Größe: 16.5 MB
Tokugawa Ietsuna, Tokugawa Iemitsu, Tokugawa Hidetada, Tokugawa Ieyasu, Tokugawa dynasty, Japan, Tokugawa Tsunayoshi, Volcker Says He Is Confident Capitalism Will Survive, George Soros, www.MichaelJacksonForSale.Com, Prepare for a climate-changed world, say engineers , AWESOME Circus trick!! (???? ?...
Datum: 23.02.2009 14:00 •
Größe: 20.8 MB
Joanne records a response video to a response video to Andy Warhol Eating a Hamburger.
Datum: 20.02.2009 16:00 •
Größe: 16.2 MB
A breakdown of what it means to sign a ‘Terms of Service’ contract on web services. Facebook Hording Your Content? , Facebook has gone too far , Facebook: all your content are belong to us. FOREVER! Protests ensue., Beware of Facebook?s New Terms of Service, I?m Done With Facebook , Inte...
Datum: 19.02.2009 19:00 •
Größe: 18.5 MB
Rocketboom Field Correspondent Ruud Elmendorp covers the return of hostages and military cargo after the ship the MV Faina was seajacked and held by Somali pirates for 19 weeks. The ship was carrying 33 refurbished Soviet era T-72 tanks and at least 14,000 rounds of ammunition. One crewmember died d...
Datum: 18.02.2009 13:00 •
Größe: 17.2 MB
The Phantom, Chicken Mountain, Feather scientists have Christmas all wrapped up, Study: Birds shifting north; global warming cited, India to launch cow urine as soft drink, WWWelcome Mat, Hippotato, The Difference Between First Class And Coach, Devolve Me, I Find This Humerus , Twelve Animals: Worl...
Datum: 17.02.2009 13:00 •
Größe: 22.1 MB
:D, @onehipmama LOL, pizza!!, John Keats Quotes, Drew Olanoff’s auction to tattoo your Twitter username on his arm for charity, Bidding ends Monday, Make A Wish Foundation, Twestival to raise over $1 Million, for charity:water, Rocketboom at the Shorty Awards, Twitter raises $35 million in fu...
Datum: 16.02.2009 14:00 •
Größe: 22.5 MB
Explaining Evolution. An animation in collaboration with Adam Quirk of Wreck and Salvage. Happy Darwin Day!
Datum: 12.02.2009 14:00 •
Größe: 37.7 MB
Rocketboom Spotlight on Nilo’s Story by Omar Khalifa. Nilofar Habibi, a presenter with Herat TV in Afghanistan, became a symbol of resistance for women journalists in the summer of 2008. In the face of death threats for working as a journalist, Habibi decided to keep working. This is her story...
Datum: 11.02.2009 14:00 •
Größe: 24.1 MB
Poland’s Wedding to the Sea, Kamera internetowa - Puck Rynek, 56-year-old becomes 1st woman to swim Atlantic , Basement Horse, Image at Dade City car dealership is Jesus, some say, Amazon.com: Chemical Shifts and Coupling Constants for Silicon-29: $8539.00 & eligible for free shipping with...
Datum: 10.02.2009 14:00 •
Größe: 15.4 MB
Johannes Kreidler - Charts Music - Songsmith fed with Stock Charts, Job Losses In Recent Recessions, Facepalm, Barney Stinson’s Video Resume (fictional character on ‘How I Met Your Mother’), Proof: Japan Discovered Numa Numa, Simroid (a.k.a. ‘Pain Girl’), Would you name...
Datum: 09.02.2009 14:00 •
Größe: 20.2 MB
Scary ‘Mary Poppins’ Recut Trailer, Honorificabilitudinitas, Supercalifragilisticexpialidocious, ablative, Anarchy Graffiti, punk band, Antidisestablishmentarianism, History of the Church of England, Henry VIII, Thomas Cranmer, Martin Luther, floccinoccinihilipilification, Nose Hair, Dus...
Datum: 06.02.2009 07:00 •
Größe: 33.1 MB
Rocketboom Field Correspondent Ruud Elmendorp visits an ice skating rink in Nairobi, Kenya.
Datum: 05.02.2009 16:00 •
Größe: 21.3 MB
Extinct Pyrenean Ibex Cloned, ‘monument of unity’ by graft architects, imm cologne 09: ‘hendekagram’ by qed*, Proteus Motor Swims Through Bloodstream, Looks Pretty Much Like a Sperm, Across the ocean in a pedal-powered submarine , Aquarium Telephone Booth, Video game condit...
Datum: 04.02.2009 20:00 •
Größe: 13.4 MB
World submarine racing championship, Did Nazi angel of death Josef Mengele ‘created twin town in Brazil’?, Candido Godoi, Josef Mengele, Solving Rubik’s cube for speed, 43,252,003,274,489,856,000, 3 x 3 x 1 rubik’s cube is just a wee bit too easy to solve, Rubik’s 360, ...
Datum: 03.02.2009 21:28 •
Größe: 20.7 MB
Scenes from the Chinatown Lunar New Year Parade in New York, NY. Music by Podington Bear.
Datum: 02.02.2009 15:00 •
Größe: 33.8 MB
Rocketboom coverage of 2009 ROFLThing NYC: Font designer Vincent Connare talks about the history of his most famous work, Comic Sans. Music by Podington Bear.
Datum: 30.01.2009 17:00 •
Größe: 31.5 MB
Joanne interviews Justin Ouellette and Luke Crawford about the recent relaunch of Muxtape, a platform for independent musicians and their fans. Music by Podington Bear.
Datum: 29.01.2009 23:00 •
Größe: 44.1 MB
Rocketboom coverage of 2009 ROFLThing NYC: Joanne interviews Jason Scott about Sockington the Cat, the most popular cat on Twitter. Story links: Huzzah Socks Army, Rudy the Parrot, Rainy the Horse, Sockington Pics. More great music by Podington Bear.
Datum: 28.01.2009 16:00 •
Größe: 23 MB
Rocketboom coverage of 2009 ROFLThing NYC: Joanne talks to Ji Lee, creator of The Bubble Project.
Datum: 27.01.2009 16:00 •
Größe: 30.6 MB
Rocketboom coverage of 2009 ROFLThing NYC: Joanne interviews Alexis Ohanian, co-founder of Reddit. Awesome music by Podington Bear.
Datum: 26.01.2009 18:00 •
Größe: 25.7 MB
Miniature City. Inspired by Little People. Music by Drew.
Datum: 23.01.2009 19:00 •
Größe: 27.2 MB
Is Obama President dot com?, Am I Watching Rocketboom dot com?, Is My Computer On dot com?, Inauguration Day on Twitter, Payment processor Heartland reports breach, 2008breach.com, World?s Fastest Calculator Operator, 15 Ridiculous Rocket and Jet-Powered Vehicles, ??????????Z, WMMNA: The Office of ...
Datum: 22.01.2009 16:00 •
Größe: 22.7 MB
Images, tweets, and posts from the 2009 Inauguration of President Barack Obama.
Datum: 21.01.2009 16:00 •
Größe: 17.5 MB
Rocketboom Field Correspondent Ruud Elmendorp reports from the birthplace of the father of U.S. President Barack Obama, Kogelo, Kenya as they prepare for Obama’s inauguration. Also see previous coverage of Kenya and Obama.
Datum: 20.01.2009 19:00 •
Größe: 20.3 MB
Otho, Rome, Roman Emperors, The Evolution of Dance 2 Proves You Can?t Go Home Again, Carnival - World?s Largest Pinata, Swing Skirt, Hello Kitty Death Cake, World’s Most Disgusting Ice Cream, Man Solves Rubik?s Cube After 26 Years, Initials Engraved on Fingernail (May, 1932), Scientists extrac...
Datum: 20.01.2009 05:30 •
Größe: 16.4 MB
Edgar Allan Poe’s 200th Birthday, The Raven, Interior Crocodile Alligator, Martin Luther King Jr. Day, MLKDay.gov
Extra: A Rocketboom Reading of the “The Raven” by Edgar Allan Poe
Datum: 19.01.2009 04:00 •
Größe: 22 MB
Rocketboom rides along during the 2009 No Pants Day Subway Ride by Improv Everywhere.
Datum: 16.01.2009 13:00 •
Größe: 17.8 MB
Rocketboom Field Correspondent Ruud Elmendorp reports on latrines that convert bio-waste into fuel.
Datum: 14.01.2009 13:00 •
Größe: 15.1 MB
The environmental impact of Google Searches, related Techmeme thread, Powering a Google Search, Dogpile, HowStuffWorks: Does gum really stay in you for seven years?, Chewing gum burns 70 kilocalories per hour, Cognitive vaccine: using Tetris to fight PTSD, Lobster to regain his freedom at age 140, 8...
Datum: 13.01.2009 16:00 •
Größe: 29.7 MB
Ellie finds out about WiMax at the 2009 Consumer Electronics Show in Las Vegas, Nevada.
Datum: 12.01.2009 19:00 •
Größe: 45.2 MB
Scenes from the 2009 Consumer Electronics Show in Las Vegas, Nevada. (Special thanks to Intel for sponsoring us!)
Datum: 10.01.2009 16:00 •
Größe: 43.2 MB
Stay tuned for the Rocketboom CES video pool being filled throughout the day at rocketboom.com/ces09
Datum: 09.01.2009 14:30 •
Größe: 8.4 MB
Every morning Palestinian workers queue to cross the Gilo checkpoint into Jerusalem. Video courtesy of Socialautopsy. (thx, Hamish!) For related coverage on the disputed territory of the West Bank and the Gaza Strip see Qassam rockets in Sderot, Israel, and Bordering Barriers: Jerusalem.
Datum: 08.01.2009 05:00 •
Größe: 24.1 MB
Joanne speaks with Phillip Torrone, Senior Editor of Make Magazine about the recent launch of Make Television on PBS.
Datum: 07.01.2009 06:06 •
Größe: 19.8 MB
Mac Rumors, AppleInsider, The Unofficial Apple Weblog, 9to5mac, Stevenote, No Pants 2k9 Details for NYC, Gothamist: Last of the NoPants8 Acquitted, Instructables: Steam Powered Potato Pistol 1.0, NASA: Ares Launch Vehicles, Defense Dept Could Share Resources With NASA, ????????, Make TV, MAKE Makes ...
Datum: 06.01.2009 16:06 •
Größe: 23 MB
Abolishing leap second could spell the end for GMT in just two years time, Civil Global Positioning System Service Interface Committee, ITU RRB Members, Korea vs. Japan, Do a Barrel Roll on the MemeDB, Do a barrel roll! (video), Kingston Fossil Plant: Natural Hazards, Magibon ??26?, Previous Rocketb...
Datum: 05.01.2009 04:00 •
Größe: 21.3 MB
Star Wars Kid, Star Wars Kid: The Data Dump, Andy Baio, Star Wars Kid, Montreal, Numa Numa, South Park Numa Numa, New Numa - The Return of Gary Brolsma!, La Caida de Edgar (Edgar’s Fall), edgar’s revenga, La caida de Edgar (Entrevista), Thinkpad image, Star Wars Kid Files Lawsuit, Star W...
Datum: 02.01.2009 09:00 •
Größe: 36.6 MB
Shiba Inu Puppy Cam, AKC MEET THE BREEDS®: Shiba Inu, I Can Has Cheezeburger, Hahaha, Laughing Baby, Kawaii, Twitter Search for ‘puppy+cam’, Adorable beyond EVERYTHING, Puppycam popularity (Today Show, CNN, and NBC), Puppy Cam Basically The Happiest Thing In The World, Puppy Cam!, But Wh...
Datum: 01.01.2009 13:00 •
Größe: 27.4 MB
Project Chanology, Message to Scientology, Anonymous (group), The Traditions of Guy Fawkes Night, An Illustrated History of Scientology, Tom Cruise Attacks Oprah, Tom Cruise Scientology Video, Streisand effect, The Great Habbo Raid of July 2006, The Habbo Hotel Raid Pool’s Closed, Fox News ...
Datum: 31.12.2008 15:00 •
Größe: 47.2 MB
Sarah Palin Bikini Pictures: Fake Photos Hit The Web, Sarah Palin on Saturday Night Live, Super Obama Girl, Obama Explains His Tax Cut Plans To Plumbing Business Owner, More Racism at a Palin Rally in PA, I Feel Pretty, Barak Obama is Your New Bicycle….., Palin on her insight into Russian Poli...
Datum: 30.12.2008 13:00 •
Größe: 42.9 MB
Disaster Girl, Photographer Dave Roth, Disaster Girl on Buzzfeed, Disaster Girl animation, Responses to Disaster Girl. For more Know Your Meme visit http://www.knowyourmeme.com
Datum: 29.12.2008 15:55 •
Größe: 20.9 MB
Lip Dubbing: Crazy, Lip Dubbing: Lovefool, Jakob Lodwick, Programmer, Ashlee Simpson on SNL, Milli Vanilli - Blame It On The Rain, Paul Simon - You can call me Al, Andy Kaufman performs Mighty Mouse, Jakob Lodwick, Numa Numa, O-Zone, Dra-gos-tea din tei (RealVideo link), Lip Dub - Flagpole Sitta by ...
Datum: 26.12.2008 16:00 •
Größe: 45 MB
??? ?12 ???, Me doing nothing, Magibon, Nothingness, Astro Boy, Kamichama Karin, Ulzzang, ulzzang before and after pictures, Asian Transformation (ulzzang style), round eye envy, ???????????, Lonelygirl15, First Blog / Dorkiness Prevails, MAGIBBOOONNN!!1, To Magibon from GyaO 1, Re: To Magibon from ...
Datum: 24.12.2008 13:00 •
Größe: 41.4 MB
Iraqi Journalist Throws Shoes at Bush, Muntader al-Zaidi, Iraq Shoe Tosser Guy: The Animated Gifs, Mid East press glee at shoe throw. For more Know Your Meme visit http://www.knowyourmeme.com
Datum: 23.12.2008 19:00 •
Größe: 18.9 MB
Boom Goes The Dynamite, NewsLink Indiana, Brian Collins on CBS, BGTD: Golf, BGTD: Football, BGTD: Baby Playing Basketball, BGTD: Veronica Mars, Scott Van Pelt, Brian Collins on KXXV, The Return of Brian Collins, Despite ‘worst’ sportscast, Collins says he’d try again. For more visi...
Datum: 22.12.2008 13:00 •
Größe: 23.8 MB
Wishing everyone a Happy Holidays!
Datum: 19.12.2008 13:00 •
Größe: 18.2 MB
The Spectrum Letters To The Editor for December 8, 2008, Parowan Prophet, In Utah, the Parowan Prophet predicts disaster will prevent Obama from taking office, O.J. Simpson Behind Bars on MyNetworkTV’s “Jail”, Lucky Man, My way, A view, Al Gore, The OLPC Children’s Machine XO...
Datum: 18.12.2008 06:00 •
Größe: 46.6 MB
Rocketboom Field Correspondent Ruud Elmendorp investigates banking through mobile phones in Kenya.
Datum: 17.12.2008 13:00 •
Größe: 23.4 MB
Rocketboom visits the opening of the Epithelium Studio Exhibition at the Pratt Institute School of Architecture.
Datum: 16.12.2008 19:00 •
Größe: 35.9 MB
December 2008 Leap Second, Embloggery, 1,300 graduate students who struggle to sell the pork ashamed? (via China Smack), China Gets World of Warcraft Themed Restaurant, Pickle Sickle, Anyone?, Zoo animals need to slim down (via ScienceBlogs), Stars orbiting the Supermassive Black Hole at our Galact...
Datum: 15.12.2008 13:00 •
Größe: 98.5 MB
Joanne visits BugLabs a manufacturer of open-source DIY electronics kits for hacking and physical computing.
Datum: 12.12.2008 08:54 •
Größe: 66.5 MB
Rocketboom Field Correspondent Ruud Elmendorp looks into the growing trend of designing minibuses in Kenya. MatatuMania website.
Datum: 11.12.2008 07:30 •
Größe: 45 MB
WANTED: Somebody to go back in time with me, Robot First Test, MechRC Humanoid Robot, 46 days left, Bush approval ratings climb, China’s .cn Now the Second Most Popular TLD, Live webcam in Inglewood, United States, Randy’s Donuts
Datum: 10.12.2008 14:00 •
Größe: 27 MB
Why Men Are Superior to Fish (Nov, 1931), World guitar speed record: starts at 170 and reaches 320bpm!, Tiago Della Vega, Chrysler’s 800-unit hybrid program, How The Not-So Big Three Rolled Into Washington, D.C., First draft of Automaker Bailout Bill is out, G.M.?s Latest Great Green Hope Is a...
Datum: 09.12.2008 11:00 •
Größe: 37.7 MB
Joanne interviews Andre Heller of Doctors Without Borders (MSF) about Condition: Critical, a project documenting the plight of the civilians caught in 15 years of war in the Democratic Republic of Congo.
Datum: 08.12.2008 12:00 •
Größe: 28.7 MB
Rocketboom spotlight: Iran: A nation of bloggers by Aaron Chiesa, Toru Kageyama, Hendy Sukarya, and Lisa Temes, students the Vancouver Film School.
Datum: 05.12.2008 16:00 •
Größe: 13.5 MB
Stacking Routine, Obama-Biden transition site Change.gov now under a Creative Commons license, Change.gov, 92 nations sign cluster-bomb ban; US, Russia don’t, Do we really need to bring back the mammoth?, Planet of the Neanderthals, Early Popped Collars, Blackboard, May Ball, May Bumps, Axel F...
Datum: 04.12.2008 05:00 •
Größe: 44.5 MB
Ellie interviews Don Tapscott, author of Grown Up Digital.
Datum: 03.12.2008 10:00 •
Größe: 55.3 MB
Motoman industrial robot cooks okonomiyaki, See-saw bike, NASA Mars photo leaked - wood found on mars!, NASA, Edna Parker dies at 115, Portugal, Supercentenarian, Oldest people, Maria de Jesus, The Big Picture by Helen Marshall, Arthur James Bunce, NY Times Obama Newspaper - Brand new - never opened...
Datum: 02.12.2008 07:00 •
Größe: 11 MB
Joanne visits Global Nomads Group, a non-profit organization using video conferencing technology by Polycom to connect schools with scientists working on the Offshore New Harbor Project in East Antarctica.
Datum: 01.12.2008 12:00 •
Größe: 49.8 MB
The 2008 Macy’s Thanksgiving Day Parade from New York City. Music: Symphonie Fantastique (1830) by Hector Berlioz, The Planets by Gustav Holst
Datum: 28.11.2008 13:00 •
Größe: 27.8 MB
The Annual Rocketboom Thanksgiving Day Parade Special. See also, The Bluies vs. The Peachies, The Imperial March
Datum: 27.11.2008 16:00 •
Größe: 62.6 MB
Joanne takes at look at Wavefunction and Less Than Three, two interactive sculptures by Rafael Lozano-Hemmer at the Bitforms Gallery in New York City. Music by Podington Bear.
Datum: 26.11.2008 12:00 •
Größe: 47 MB
Ellie Rountree visits the redesigned Art Gallery of Ontario in Toronto, Canada. Music by Podington Bear.
Datum: 25.11.2008 21:39 •
Größe: 47 MB
Assam, Lachit Borphukan, Mughal Empire, Battle of Lottorf, Happy Evolution Day!, Welcome Back, World’s first truly blue roses go on display in Japan, Shiba Inu Puppy Cam, Shuba Inu Dude Cam Parody, Color changing house by Italo Rota, Upside-Down Sky Planters Save Water and Space, Guerilla gard...
Datum: 24.11.2008 14:00 •
Größe: 28.2 MB
Explaining Evolution. An animation in collaboration with Adam Quirk of Wreck and Salvage
Datum: 21.11.2008 23:00 •
Größe: 37.7 MB
Ocean Dead Zones Growing; May Be Linked to Warming, Ocean ?Dead Zones? on the Rise , Scientists alarmed by ocean dead-zone growth, Ocean ‘dead zones’ expanding worldwide: study, What are Dead Zones?, Caspian Sea from orbit, Potomac River, Couleurs, Phosphate, Nitrate ion, Surface runoff,...
Datum: 20.11.2008 21:00 •
Größe: 29 MB
Joanne visits mechanical sculptor Steve Gerberich. Music: Miles Davis Video Game Music by Tyler Riggs
Datum: 19.11.2008 14:00 •
Größe: 22.3 MB
What will life be like in the Year 2008?, Steve Rubel: The End of Tangible Media is Clearly in Sight, Ji Lee’s Dead Bull, Space Shuttle Mission ST-126, Heidemarie Stefanyshyn-Piper, Steve Bowen and Shane Kimbrough to spacewalk, Finger Forks, Hands Help, Macbook Pros and Playstation Controllers...
Datum: 18.11.2008 11:00 •
Größe: 18.2 MB
OpenID, Internet 2, Sick guitar trio video, IE 8 Beta, History of video game consoles (fourth generation), IPv4, Unseen 64, Team 128: Genetics of common neurological diseases, day two fifty six. we were framed, Finger binary, Browser Display Statistics, Intel predicts singularity by 2048, Making 4,0...
Datum: 17.11.2008 15:00 •
Größe: 10.1 MB
Joanne trains with Flynn from The New York Jedi lightsaber enthusiasts collective.
Datum: 15.11.2008 00:00 •
Größe: 28.5 MB
A coalition of artist-activists led by The Yes Men prank commuters and hack the media with fake copies of the New York Times. NYTimes Special Edition News Release, NY1 In The Papers 11/13/2008, Russia Today: ‘War in Iraq is over’, Gefälschte Zeitung erklärt Ende des Irak-Kriegs, Google N...
Datum: 13.11.2008 16:00 •
Größe: 48.2 MB
Dust Storm Cuts Energy Supply of NASA Mars Rover Spirit, MarsPhoenix on Twitter, Spirit, hit by a regional dust storm, has reached lowest power levels ever, Oppy is heading out on a road trip, Cassini Saturn, Interview with Veronica McGregor, Amazing Japanese Zoo Training Drill With Fake Rhino, C...
Datum: 12.11.2008 16:00 •
Größe: 23.4 MB
Joanne interviews Blair Singer, writer of the play ‘The Most Damaging Wound’ at Manhattan Theatre Source in New York City. Music: Jackie and Flow by Podington Bear.
Datum: 11.11.2008 12:00 •
Größe: 50.6 MB
Joanne interviews the people behind ‘Doctor Atomic’, an opera about the making of the first atomic bomb. ‘Doctor Atomic’ is being performed at the Metropolitan Opera of New York City.
Datum: 10.11.2008 12:00 •
Größe: 30.7 MB
If time was infinite and space was finite everything would repeat.
Datum: 07.11.2008 16:00 •
Größe: 16.2 MB
Dilate or Shrink Your Pupils on Command, voluntary pupil dilation, Frotzophone, Fireworks Help Find Your Car, Fireworks to Pinpoint Your Car, Capital Gate - World?s Most Inclined Tower?, Scientists find way to erase memories in mice, Inducible and Selective Erasure of Memories in the Mouse Brain via...
Datum: 06.11.2008 16:00 •
Größe: 30.7 MB
Joanne interviews Jacob Soboroff of WhyTuesday.org about the state of election reform and increasing civic participation in American politics.
Datum: 05.11.2008 13:00 •
Größe: 36.1 MB
Rocketboom Field Correspondent Ruud Elmendorp covers the “frenzy” over the American presidential candidate Barack Obama in Kisumu, Kenya, the home area of Obama’s father.
Datum: 04.11.2008 19:00 •
Größe: 39.7 MB
Joanne interviews the creators of Project Bueller, an effort to recreate the iconic parade float scene from the movie Ferris Bueller’s Day Off at the 2008 New York City Village Halloween Parade.
Datum: 03.11.2008 19:00 •
Größe: 133 MB
Video from the 2007 NYC Halloween Parade. Come back later this weekend for footage from this year’s 2008 NYC Halloween Parade.
Datum: 31.10.2008 13:00 •
Größe: 123.6 MB
Atlas of the Netherlands, Global Warming and Coastal Deltas: Is The Netherlands Europe’s Bangladesh?, Dan Ardia’s Travel Photos, Houesboats, Waterstudio’s Flood Resistant Architecture, New York City, Waterarchitecture, Koen Olthuis of WaterStudio.nl, Floating Homes in Seattle, Spir...
Datum: 30.10.2008 13:00 •
Größe: 55.6 MB
Joanne interviews participants at a coding party for the Twitter Vote Report distributed vote monitoring system at the Not An Alternative gallery in Brooklyn, NY. Vote Report on Twitter, Vote Report Volunteer Kit, Nancy Scola. Music: Koshka-Garmoshka by Olga Scotland and .
Datum: 29.10.2008 18:00 •
Größe: 58.4 MB
NASA TV to Air Station Crew Messages on Voting, 10th Anniversary , Sunsets and Plantbots, Singapore?s Ecological EDITT Tower, Pothos The Twittering Plant, Potted plant blogs in Japan, Midori-san livecam, Midori-san livecam machine-translated Japanese to English, Kenya’s elephants send text mes...
Datum: 28.10.2008 12:00 •
Größe: 33.6 MB
Electronic Facial Contortionist, Armadillo Aerospace, Northrop Grumman Lunar Lander Challenge, ColabSpace: Northrop Grumman Lunar Lander Challenge 2008, John Carmack, The Bloodhound Project, Antipodr, Human species ‘may split in two’, Trolls
Datum: 27.10.2008 13:00 •
Größe: 22.6 MB
Blazing Star, FAIL group on Flickr, Fail Blog, Fail Dogs, a collection of FAIL images, Pro Wrestling, a collection of pwnage, 1895 Montparnasse train wreck, What is Mayonnaise anyway?, Darwinian Evolution, Charles Bosk’s “Forgive & Remember”
Datum: 24.10.2008 12:00 •
Größe: 25.9 MB
The Sistine Chapel, James Ussher, Jesus on a Dinosaur, Plantbot, Human powered sunset will get you in the mood, Dim, Alison v modern architecture Baritone smoke alarms wake the deepest sleepers, images 1, 2, FishPhone, Finally, a microscope that can see an atom, FEI Titan 80-300 Cubed TEM, IBEX: Int...
Datum: 23.10.2008 19:00 •
Größe: 57.5 MB
A new amended law in Switzerland protects the dignity of vegetation, Gene Technology Act 2000, Giant Pink Bunny (Piemonte, Italy), Interpol proposes world face-recognition database, Bright ideas come to us at night, not in office hours, Head Kenzan massager will give Osim uCrown a run for its money,...
Datum: 22.10.2008 15:00 •
Größe: 31.5 MB
Video taken outside of a McCain-Palin rally produced by Keystone Progress.
Datum: 21.10.2008 13:30 •
Größe: 44.9 MB
Rocketboom field correspondent Chuck Olsen interviews Bruce Sterling on the concept of Spimes
Datum: 20.10.2008 13:00 •
Größe: 33.3 MB
line rider, music: tank! by yoko kanno and the seatbelts
Datum: 17.10.2008 13:00 •
Größe: 7.6 MB
Heavy Metal-Eating “Superworms” Unearthed in U.K., death metal images 1, 2, Death Metal music streaming, One-of-a-kind Microorganism Lives All Alone, At 2.8 km down, a 1-of-a-kind microorganism lives all alone, Angry about economy? Smash some plates and move on, Man writes with tears, Th...
Datum: 16.10.2008 17:00 •
Größe: 43.7 MB
Rocketboom Field Correspondent Ruud Elmendorp sails with the Dutch Navy who are protecting vessels of the World Food Programme from pirates off the coast of Somalia. More than 60 ships have been attacked by pirates off of African waters in the past year.
Datum: 15.10.2008 18:00 •
Größe: 31 MB
Joanne speaks with artist Lincoln Schatz about his project CUBE Portraits currently on display at the Hearst Tower in New York City. Watch more Rocketboom Interviews
Datum: 14.10.2008 12:00 •
Größe: 45 MB
Superpower, Cities With The Most Skyscrapers in the World, Malaysia’s Petronas Towers, Most Populated Countries in the World, CIA World Factbook - Rank Order of Internet users, Who Owns 2.2 Trillion of the US Debt?, Human Development Index, United Nations Development Program, Denmark ‘wo...
Datum: 13.10.2008 12:00 •
Größe: 31.4 MB
O RLY? More Know You Meme, Something Awful: What was the weirdest/funniest answer you ever put on a test?, Original Snowy White Owl Image Silly looking Face by John White, Animated LOL gif, O RLY?, YA RLY, NO WAI!!!, NO, NOT RLY., O RLY on ED, Kungfubaby O RLY, O’Reilly O RLY, The O RL...
Datum: 10.10.2008 07:09 •
Größe: 50 MB
KVLY-TV Mast in North Dakota, KVLY-TV Mast at Google Earth Hacks, Previous episode on the ‘Tallest Buildings In The World’, Taipei 101, [map], Burj Dubai blog, As world’s economy crumbles, Dubai keeps on building, [map], The Aerium Artificial Tropical Resort, [map], Venetia...
Datum: 09.10.2008 13:00 •
Größe: 31.8 MB
Joanne interviews Craig Newmark, founder of Craigslist about activism, politics and accountability in government.
Datum: 08.10.2008 16:00 •
Größe: 40.1 MB
Rocketboom Field Correspondent Ruud Elmendorp speaks with Morris Mbetsa, the 18 year old inventor of a system that allows you to monitor your car via SMS.
Datum: 07.10.2008 18:16 •
Größe: 27.7 MB
Teenar pulls all the right strings, Teenar, Girl Guitar - Fashion Preview, Political candidate punches TV host, 2, Chuwit Kamolvisit, PeriPeri, Endless PeriPeri toy simulates the feel of opening cardboard boxes, Magnetic Movie, Exemption from excise tax for certain wooden arrows designed for use by...
Datum: 06.10.2008 13:03 •
Größe: 33.8 MB
Voting, Vote For Change, State by State Voter Laws and Registration Deadlines, Vote 411, Project Vote Smart, Orange Moon, Halloween Pet Costumes, 2008 Candy Toy Product Review, Winston Churchill, Genghis Khan, Oh Hell No, Rock The Vote, All Gizah Pyramids, Rosie the Riveter
Datum: 04.10.2008 00:00 •
Größe: 26.7 MB
Urban Black Bears ?Live Fast, Die Young”, 1, 2, World’s First Tidal Turbine Farms to Power 40,000 Scottish Homes (or Pubs), Solar panels installed on Vatican roof, Le Projet Triangle by Herzog & de Meuron, New Paris Building Casts No Shadows, Generates Electricity, Walter Towers by B...
Datum: 02.10.2008 13:00 •
Größe: 66 MB
Internet Corporation for Assigned Names and Numbers (ICANN), Domain name expansion ‘like gold rush’, changing to Biggest Expansion in gTLDs Approved for Implementation, Easily mispronounced domain names, the OpenNIC Project, Open Root Server Confederation (ORSC), the Public-Root
Datum: 01.10.2008 13:00 •
Größe: 21.3 MB
Nuvvuagittuq, Superior craton, and Tonalites, Zircon, Table of Condiments That Periodically Go Bad (1, 2, 3), Nature Jewelry, 2009 Lincoln Bicentennial One Cent, Preventing forest fires with tree power, Voltree Power, The human airbag that will protect the elderly if they fall, NASA’s Glory, ...
Datum: 30.09.2008 13:40 •
Größe: 42 MB
Rocketboom field correspondent Tim Brunsden of Liverpool Stories speaks with David Allin about ‘Joyful Trees‘, an architectural art installation created by Diller + Scofidio + Renfro for the 2008 Liverpool Biennial.
Datum: 29.09.2008 22:49 •
Größe: 41.8 MB
All About Beards, Beards and Baldies, BLF - Beard Liberation Front, Famous Beards Throughout Time, Beard Cricket, World Beard and Moustache Championships, 2007 Winners, growing beards, beard competition
Datum: 26.09.2008 13:00 •
Größe: 21.3 MB
Anti-gravity, NASA footage of zero gravity plane, Go-Fast Jetpack, Mythbusters on the Anti-Gravity Lifter Myth, Expl of dynamical BB effect from stand point of ZPF field by T. Musha, Biefeld Brown Effect, UFOs-NASA, Gary McKinnon, Free Gary McKinnon dot org dot uk, Brian Cox, D:Ream, What on Earth i...
Datum: 25.09.2008 13:00 •
Größe: 49.7 MB
A visit to David Blaine who is hanging upside down for 60 hours as part of his Dive of Death in Central Park, New York City. Music by b-man. Previously on Rocketboom: Joanne interviews David Blaine in Times Square.
Datum: 24.09.2008 12:59 •
Größe: 27.3 MB
Tim O’Reilly, Web 2.0 Expo New York, Conflux: Vertical Bed, Office for the development of Substitute Materials*, Artificial Time Travel, Astrophysicists weigh galaxy’s most massive star, China to snap four shuttles together to build a space station, Zhai Zhigang, China names new crew for...
Datum: 23.09.2008 19:42 •
Größe: 41.6 MB
Joanne interviews Susan Crawford of One Web Day Music by Podington Bear.
Datum: 22.09.2008 13:00 •
Größe: 45 MB
Pirates are alive and well on Talk Like a Pirate Day.
Datum: 19.09.2008 13:00 •
Größe: 38.3 MB
Mickey Mouse must die, says Saudi Arabian cleric (1, 2, 3), Search for Lehman Brothers on eBay, Hurricane IKE Wind!, Future Victim of Everest to Ride Down Mountain on a Unicycle, Oil Addiction Wrecked My Life, Anti-Theft Lunch Bag Deters Sandwich Thieves, World’s oldest man to celebrate 113t...
Datum: 18.09.2008 21:40 •
Größe: 28 MB
The Instant Grant Program by The Federation of Students and Nominally or Unemployed Artists
Datum: 18.09.2008 03:38 •
Größe: 137.2 MB
‘Space traffic control’ needed in junk-filled orbits, Flaming space junk narrowly misses jet (2007), New Horizons, ‘Brain Transplant’ Successful as Checkout Continues, New Horizons on Twitter, Rocketboom on Twitter, Creature Survives Naked in Space, Tardigrades, Tardigrade F...
Datum: 17.09.2008 01:00 •
Größe: 32.2 MB
President Sarah Palin, President John McCain, Black Box Voting, President Tom Cruise, Pleiades, The CPU Roadmap, The Wireless Roadmap, I Drink Your Milkshake, Living in Polar Cities, Michael Phelps First Race, Mayan Calendar ends on December 21, 2012, The Sun’s Magnetic Poles Will Reverse in 2...
Datum: 15.09.2008 13:00 •
Größe: 27.1 MB
Joanne finds her rhythm in Central Park.
Datum: 12.09.2008 20:00 •
Größe: 24.4 MB
Story of a City: New York (1946), Alley Shop, The Gates, Central Park, February 2005, New York, New York, Columbia University - Campus Tour, Times Square Sinema 1970, LED Throwies 2, Crowne Plaza Hotel, Time Square, New York Hotel Room Video, 911 Memorial, guggenheim museum, CPDSA Disco Skating, Cen...
Datum: 11.09.2008 13:00 •
Größe: 111.8 MB
Rocketboom Spotlight: La Princesse, a giant mechanical spider documented by Tim Brunsden of Liverpool Stories.
Datum: 10.09.2008 09:00 •
Größe: 25.2 MB
Huge tribute to Lenin visible on Google Earth, Marshal Mcluhan, Cold War, Nazca Lines, Microminiature Art, more, a look at the 2008 Ars Electronica Festival from sms ;), the Muwi Mower by Yuli Sung
Datum: 09.09.2008 13:00 •
Größe: 41.9 MB
Michelangelo’s David, Spore Gets World’s Tiniest Billboard, Requires Telescope To See, Spore’s DRM is awesome, 9000!! NINE THOUSAAAAANDD!, Feature Film to be Released on MySpace, The Mannsfield 12, Michael Moore to release new film for free online, Michael Moore’s Slacker Upr...
Datum: 08.09.2008 10:00 •
Größe: 31.3 MB
La Caida de Edgar (Edgar’s Fall), Caida de Edgar (Original), Caida de Edgar Counter Strike (in video game), La Caida de Edgar (Emperador), Cuahtemoc Caida Edgar Lavolpe Ya Weey Llevame Animanda (cartoon), La caida de Edgar a Entrevista (talk show), Edgar’s Fall YTMND, More Know You Meme
...
Datum: 05.09.2008 13:00 •
Größe: 52.9 MB
Rocketboom Field Correspondent Ruud Elmendorp reports on the recent murder of albino people in Tanzania, killed for their organs. Groups like the Tanzania Albino Society are trying to put these killings to an end.
Datum: 04.09.2008 13:00 •
Größe: 19.1 MB
Geek Weddings, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, Nine medieval ships found in Oslo mud, Viking Ship Museum, Norway beachcam, USB Webmail Notifier from Dream Cheeky, Observation Point Svenstavik, Gene tests ’show man could live to a healthy 125 and remove threat of cancer’, Spore...
Datum: 03.09.2008 13:00 •
Größe: 34.9 MB
Star Trek warp drive is a possibility, say scientists, Mass-energy equivalence, Danger Bomb Clock, Sky survey yields new cosmic haul, Asteroid belt, Asteroid belt image, Kuiper belt, Milwaukee Polar Bear Club, Rosetta Disk Designed For 2,000 Years Archive, image of The Future, Very Long-Term Backup...
Datum: 02.09.2008 13:00 •
Größe: 29.6 MB
Joanne interviews Jay Sullivan, who distributes socio-political documentaries free of charge at the Union Square Subway Station in New York City.
Datum: 01.09.2008 09:00 •
Größe: 59.3 MB
Rocketboom Spotlight on The Archive, a film by Sean Dunne. Paul Mawhinney was born and raised in Pittsburgh, PA. Over the years he has amassed what has become the world’s largest record collection. Due to health issues and a struggling record industry Paul is being forced to sell his collectio...
Datum: 29.08.2008 13:00 •
Größe: 30.5 MB
Karateka Video Game, Apple II, Commodore 64, Acorn Archimedes, Portal to Maya Underworld Found in Mexico?, Yucatán Peninsula, What Is Cryonics? A Brief Introduction, Wow. McCain is a schmuck…, McCain: Passed Over, Presidential era gas prices, Bush wants US oil production increased, pushes for...
Datum: 28.08.2008 13:00 •
Größe: 29.1 MB
Joanne speaks with James Powderly of Graffiti Research Lab upon his return to the United States after he was arrested and detained in Beijing last week while preparing to perform acts of civil disobedience by Students for a Free Tibet during the 2008 Summer Olympics. Related: Back from Beijing: Bria...
Datum: 27.08.2008 13:00 •
Größe: 37.5 MB
Joanne speaks with Alive in Baghdad’s Brian Conley upon his return to the United States after he was arrested and detained in Beijing last week for videotaping acts of civil disobedience by Students for a Free Tibet during the 2008 Summer Olympics.
Datum: 26.08.2008 13:00 •
Größe: 44.8 MB
Fusion Man!, Yves Rossy, Yves Rossy makes second jet-powered flight, World’s ‘oldest man’ dies in India, Habib Miyan, Intel brings wireless power closer to the mainstream, Nikola Tesla would be proud, Democratic National Convention in Denver, Barack Obama, Joe Biden, The Uptake, Po...
Datum: 25.08.2008 10:00 •
Größe: 28 MB
Joanne interviews Brian Conley of Alive in Baghdad (Brian Conley arrested this week and sentenced to 10 days detention in Beijing)
Datum: 22.08.2008 13:00 •
Größe: 23.3 MB
James Powderly of Graffiti Research Lab, Students for a Free Tibet, GRL L.A.S.E.R. Stencil, LED Throwies, LED Throwies II, L.A.S.E.R. Tag, Enter The Ghetto Matrix, A Timeline of Noel Hidalgo’s Arrest and Deportation from China, Journalist Deported after Filming Protest in Tiananmen Square , Al...
Datum: 21.08.2008 13:00 •
Größe: 22.3 MB
Joanne interviews Cheryl Furjanic, Producer and Director of Sync or Swim a documentary about the U.S. Synchronized Swimming Team’s journey to the 2004 Olympic Games.
Datum: 20.08.2008 13:00 •
Größe: 4 MB
Ivy Bean is the World’s Oldest Facebooker at 102, Edna Parker is the Oldest Person Alive at 115, The World’s Tallest Woman was Edna Parker’s neighbor, Jeanne Calment lived 122 years and 164 days, Timothy a Greek Tortoise lived to 160, Greenland sharks can live up to 200 years, Cina...
Datum: 19.08.2008 13:00 •
Größe: 41.5 MB
Fonzie Jumps The Shark, US hunters claim to have found Bigfoot, Spain to Grant Human Rights to Great Apes, Peter Fox: Alles Neu, Career Builder Ad With Monkeys, Gerald The Gorilla Sketch, Goatee Saver (via Curiobot), The Very Loud Fenstar Flying Military Robot, Bono Leaks U2 Tracks Online by Playing...
Datum: 18.08.2008 13:00 •
Größe: 36.7 MB
The Original ‘All Your Base’ Cut Scene from Zero Wing, Engrish, Execution In Process, Not Feel Well, Get Drunk, Sexual Harassment Company, There Is A Possibility…., All Your Base Animated GIF, Zany Video Game Quotes, All Your Base Overdub by Overclocked.org, Something Awful Forums,...
Datum: 15.08.2008 09:00 •
Größe: 23 MB
Joanne interviews David Mason of the Mobile Mini Circus for Children of Kabul, Afghanistan. MMCC is a non-profit organization staffed by local Afghan artists who organize educational programs and performances for children in a war torn Afghanistan. More videos of AfghanMMCC performances.
Datum: 14.08.2008 13:00 •
Größe: 40.3 MB
Allison Carrol is Lara Croft, World’s Smallest Burger, World’s Smallest Balloon, Bloody Serial Killer Shower Curtain , Styrofoam Dome Homes, eBay Slot Machines, The 10 Oddest City Names, GMail outage pours rain on Cloud Computing parade, Isaac Hayes - Shaft - live 1973 , Scientists Close...
Datum: 13.08.2008 04:00 •
Größe: 5.2 MB
Joanne interviews Charlie Todd of the prankster comedy group Improv Everywhere. Best Buy, Frozen Grand Central, Food Court Musical, Human Mirror
Datum: 12.08.2008 13:00 •
Größe: 58.7 MB
CERN - European Organization for Nuclear Research, CERN in 3 minutes, Large Hadron Collider, Large Hadron Collider testing didn’t cause a black hole, Large Hadron Rap (thx, Alphaxion!), The Global Warming Rug Will Last 1000 Years, The US Army Wants to be Nearly One-Third Robotic by 2020, Tetra...
Datum: 11.08.2008 04:00 •
Größe: 42.1 MB
Rocketboom Field Correspondent Steve Garfield interviews the Boston Typewriter Orchestra
Datum: 08.08.2008 17:16 •
Größe: 22.9 MB
NASA, Campaign Reveals Just a Little Bit of Coke?s Secret Formula, $100,000,000,000 bill from Zimbabwe, Zimbabwe Faces 50 Million Percent Inflation, Uses Gasoline Coupons For Currency, The Zimbabwe Situation, Man Successfully Undergoes Double Arm Transplant, Goro, The Unofficial Mortal Kombat 3 Movi...
Datum: 07.08.2008 13:00 •
Größe: 22 MB
Rocketboom field correspondent Ruud Elmendorp profiles Sharif Osman, a Mombasa Camel Man or “beach boy” whose business has been hurt by tourists’ reluctance to visit Kenya after recent post-election violence. Previous Rocketboom coverage of the Kenyan election crisis: 1/8/08: Elect...
Datum: 06.08.2008 13:00 •
Größe: 13.2 MB
Water Ice on Mars Confirmed by the Phoenix Mars Lander, White House Briefed About Life on Mars, Slashdot comments on the White House being briefed about life on Mars, Montauk Monster, What’s the Big Secret About Life on Mars?, Microscopy, Electrochemistry, and Conductivity Analyzer (MECA), Can...
Datum: 05.08.2008 07:00 •
Größe: 27 MB
evolution vs. peanut butter, evolution vs. banana, laraque vs ivanans, bush vs. all people, bush standing vs bush standing, don imus vs. black people, geraldo vs. oreilly, mother vs. son, rumsfield vs. evidence, newt vs. spanish people, list of logical fallacies from the art of reason, post hoc, app...
Datum: 04.08.2008 13:00 •
Größe: 27.1 MB
Know Your Meme wiki, more Know Your Meme videos, Tina sings the Backstreet Boys, Tina Chen on PerezHilton.com, Tina strips [video removed], Tina on MySpace, Tina-SouljaBoy Remix, Tina-Angry German Kid Remix, Leave Kristina Alone, Kristina Chen on Stuff Ethnic People Like, Is This Tina in Jesus Camp?...
Datum: 01.08.2008 13:00 •
Größe: 20.9 MB
Rocketboom field correspondent Chuck Olsen of mnstories covers interactive toy sculpture artist Anastasia Ward
Datum: 31.07.2008 13:00 •
Größe: 22.9 MB
The Magic Number 30, The Airventure Airshow, of Oshkosh, Wisconsin, The Martin Jetpack, Aulophobia on Wikirage, The Celtic Football Club, of Glasgow, Scotland, The Rangers Football Club, also of Glasgow, Scotland, Aulophobia on Wikitionary, The PetPocket Bird Carrier, FriendFeed, Andrew Baron on Fr...
Datum: 30.07.2008 18:21 •
Größe: 25.5 MB
Rocketboom field correspondent Chuck Olsen covers the 3rd Annual Netroots Nation progressive politics conference in Austin, TX. Interviews with Markos Moulitsas of Daily Kos, NYU Journalism professor Jay Rosen, Karl Frisch of Media Matters, and Irwin Tang author of Gook. For more coverage, visit The...
Datum: 29.07.2008 13:00 •
Größe: 32.2 MB
Rocketboom special field correspondent Sarah Austin visits Comic-Con 2008 in San Diego, CA. Interviews with JJ Kirby and Michael Lopez of Wildstorm Comics, cosplayers, Shonen Jump, Bill Plympton, Ghostbusters, Rocketboy
Datum: 28.07.2008 13:00 •
Größe: 51.7 MB
David Byrne’s interactive art project Playing the Building at South Street Seaport in New York City.
Datum: 25.07.2008 13:00 •
Größe: 19 MB
Spammer literally walks out of prison, YouTomb tracks videos taken down for copyright violations, Deletube is now defunct, Contact Deletube, The Real Deletube, Migaloo an albino humpback whale spotted in Australia, Migaloo’s albino turtle cousin, Coral Grief, Coral Reefs Threatened by ‘B...
Datum: 24.07.2008 13:00 •
Größe: 23.3 MB
Rocketboom field correspondent Ruud Elmendorp shares with us the story of John Otieno and the continuing plight of some 300,000 internally displaced persons in Kenya as a result of the disputed presidential elections this past December. Previous Rocketboom coverage of the Kenyan election crisis: 1/8...
Datum: 23.07.2008 13:00 •
Größe: 27.5 MB
McCain: There Will Be Other Wars, Smilin’ John McCain - Tough Talk - Fool or Fraud?, Ball Bounce, Obama Talks Tough, Biography of George Washington, A Brief Profile of the Continental Army, Dwight David Eisenhower At a Glance, World War II, The Personal Memoirs of Ulysses Grant, The Civil War ...
Datum: 22.07.2008 13:00 •
Größe: 15.3 MB
The Oceanside Water Pollution Control Plant, Presidential Memorial Commission of San Francisco to name the Sewage Plant after George W Bush, Real Flying Car, The Sky Cutter .40 V2, The Flying Lawn Mower, Gear Factor Marketing, The heads of the International Space Station meet in Paris, International...
Datum: 21.07.2008 13:00 •
Größe: 27.6 MB
Joanne takes a look at The New York City Waterfalls, a public art installation by Danish artist Olafur Eliasson
Datum: 18.07.2008 13:00 •
Größe: 59.5 MB
Dallas Building Demolition, Daruma-otoshi skyscraper demolition, Dancers Blinded By Lasers At Russian Rave, Principe de fonctionnement d’un laser, St. Basil’s Cathedral and Spasskaya Tower of Kremlin, Red Square, Moscow, Ophthalmic eyepatch, Inside John McCain’s Head Again, Iran Su...
Datum: 17.07.2008 13:00 •
Größe: 20.7 MB
Rocketboom field correspondent Ruud Elmendorp investigates the village phone project bringing affordable telecommunication service to rural areas in central Uganda.
Datum: 16.07.2008 16:00 •
Größe: 21.9 MB
Send Your Name to the Moon, Creepy Japanese Crawling Robot, 2012 Supplies - Everything needed to survive 2012, Escape 2 Earth - The Novel!, Save the Clock Tower Flyer, More Fireworks, SETI Adopt a Scientist
Datum: 15.07.2008 16:00 •
Größe: 18.5 MB
Bastille Day, Louis VIII of France, About Billy the Kid, Large denominations of United States currency, Instant Origami, Internet Based Political "Meta-Party" For Massachusetts , Large Hadron Collider Countdown, for the Large Hadron Collider, Easy Boiled-Egg Shaper, USB ...
Datum: 14.07.2008 16:00 •
Größe: 21.6 MB
Story Links: Joanne contributes to the madness, er, excitement!..surrounding the release of the second generation Apple 3g iPhone. Bill Gates responds, says uh. List of more Supercuts from Waxy.
Datum: 11.07.2008 06:06 •
Größe: 7.5 MB
G8, 34th G8 Summit in Hokkaid?, Japan, The Cost of Food: Facts and Figures, Food Prices on the Rise, World Commodity Prices from 2000-2008, Percent change in food prices from 2007 to 2008, The Rising Demand for Commodities, Does Ethanol Deserve the Blame for Rising Food ...
Datum: 10.07.2008 16:00 •
Größe: 14.6 MB
Rocketboom field correspondent Ruud Elmendorp looks into the establishment of Green Computers Uganda, a public-private partnership to sell refurbished computers and spur computer use in Kampala, Uganda.
Datum: 09.07.2008 16:00 •
Größe: 22.2 MB
What Is The Oldest YouTube Video?, Me at the Zoo Uploaded on April 23 2005, The McFly 2015 Website, Back to the Future McFly Sneakers Unboxed Going for $2,000, Save The Clock Tower, Back To The Future Prop Collection on eBay, Denmark Is The World's Happiest Nation, 10 un...
Datum: 08.07.2008 16:00 •
Größe: 20.1 MB
A week before the release of the new 3G iPhone, several people have formed a line outside of the Apple 5th Avenue cube store in New York City in hopes of obtaining a World Record for the most time spent waiting in line for a purchase.
Datum: 07.07.2008 15:48 •
Größe: 66.9 MB
Forth of July, Independence Day Fireworks, New York City 2008 (more explosives than any other display in America), Star Spangled Banner by Fred Waring and his Pennsylvanians
Datum: 05.07.2008 11:37 •
Größe: 33.7 MB
Milky Way Loses Two Arms, Jim Abbott, Lt. Dan, Galileo, Copernicus, Copernicanism, Fixed Earth Believers, Keanu Reeves at Thespian Net, There's A Bomb On The Bus What Do You Do What Do You Do?, Knit Yarn Spock Ears, Explosion containment net Patent, Half RV, Half Housebo...
Datum: 03.07.2008 16:00 •
Größe: 23 MB
Joanne interviews the creator and composer behind Podington Bear, artist and musician Chad Crouch. additional story links: Hush Records, The Decemberists, This American Life, Esperanza Spalding, Daytrotter
Datum: 02.07.2008 16:00 •
Größe: 23.8 MB
story links: chaos theory (via), gaston julia, julia set, benoit mandelbrot, madelbrot set, fractals, earthquake predictions chaos, darpa security chaos, artificial intelligence chaos, pathology chaos, cardiology chaos, invader set
Datum: 01.07.2008 16:00 •
Größe: 28.2 MB
Spore Creature Creator Sporepedia, Japanese Water Powered Car Mod, The Genepax Water to Hydrogen Fuel System, Amphibious snake-like robot ACM-R5, via GeekAlerts, 'Lost' Amazon Tribe Wasn't Lost, Original Rocketboom Blog Post on the 'Uncontacted' Tribe, Michelangelo 'hid ...
Datum: 30.06.2008 16:00 •
Größe: 18.4 MB
Visiting the 2008 Coney Island Mermaid Parade at Coney Island, Brooklyn, NY
Datum: 27.06.2008 16:00 •
Größe: 34.4 MB
Story Links: Les Androides street performers, Highest Popping Toaster In World, Spinout on an escalator, El Toro Marine Corps Air Station, El Toro Missile Silos For Rent or Lease, Asimo the Robot Dances, Tay Zonday Discusses Peak Oil, Inside John McCain's Head, Rocketboo...
Datum: 26.06.2008 16:00 •
Größe: 16.3 MB
Story Links: Wednesday hump day of Woden and Mercury, 25 is the smallest square that can be written as the sum of two squares, Magibon, Ian Usher is selling his whole life on ebay, Aucution:, Onion Ring Peace sign, Smiling French Fry, Jesus Figure in a ptoato chip, Evil ...
Datum: 25.06.2008 16:21 •
Größe: 28.6 MB
Story Links: Rocketboom field correspondent Ruud Elmendorp covers pharmaceutical drug abuse in Nairobi, Kenya. For more reports from Kenya, see the Rocketboom Wiki on Kenya
Datum: 24.06.2008 17:57 •
Größe: 13.8 MB
Story Links: Disappearing Ice on Mars, Sublimation Explained, The Great Planet Debate, One Red Paperclip (the book), RealSnailMail is Real Mail via RFID chips on Real Snails, Where The Hell Is Matt 2008, Image Credits: icecubes, mars animation, mars ice cap, Pluto a plan...
Datum: 23.06.2008 16:00 •
Größe: 20.9 MB
Story Links: Summer Solstice, Music: Squirell Commotion by Podington Bear
Datum: 20.06.2008 19:32 •
Größe: 20.5 MB
Joanne plays the keyboard.
Datum: 19.06.2008 16:00 •
Größe: 11.5 MB
On the red carpet of the 2008 Webby Awards with Seth Meyers of Saturday Night Live, Ben Huh of I Can Has Cheezburger, Ludacris of WeMix.com, Shawn Hardin of Flock, Will I Am of the Black Eyed Peas, and Arianna Huffington of the Huffington Post, earlier Rocketboom coverag...
Datum: 18.06.2008 16:00 •
Größe: 51.4 MB
Battle of the Browsers continued, Firefox vs Internet Explorer, Classic Rocketboom episode from Firefox Release 2, Music Invisible Is Not Invincible by Podington Bear
Datum: 17.06.2008 16:00 •
Größe: 24.1 MB
Story Links: Leopold Bloom Bloomsday, Oshea's in Dublin live cam, Deep sea creature, Spore demo by Will Wright, Download Spore Creature Creator, Spore creature creator demo screen captures, Caring Continuum Chart, Childrens drawings into photos by Yeondoo Jung, Rocketboo...
Datum: 16.06.2008 17:39 •
Größe: 37.4 MB
Story Links: Iraq Tag Galaxy, Iraq on Arc, Iraq on Kartoo, Iraq Newsmap, Obleek Iraq War Coalition Fatalities, Iraq on Flickr, Iraq on News Spectrum, Iraq on Bigspy, Iraq on Summize, Iraq on Stack, Iraq on Think Map Visual Thesaurus, Iraq on Google News Cloud, Iraq on Se...
Datum: 13.06.2008 03:04 •
Größe: 29.3 MB
Story Links Wiimbledon 2008, Barcade, music by Podington Bear, Wiimbledon 2007 by Rocketboom
Datum: 12.06.2008 21:21 •
Größe: 16.6 MB
Story Links: Winners of the Webbys 2008 Online Film and Video Awards Including interviews with Richter Scales, 30 Second Bunnies Theatre , Tay Zonday, DailyGreens, Diggnation, Totally Rad Show, You Suck at Photoshop, Wainy Days Music: Podington Bear. See also, Rocketboom...
Datum: 12.06.2008 21:09 •
Größe: 33.7 MB
story inks: robert millis of american microphone interviews 1st lt. paul rieckhoff founder of iraq and afghanistan veterans of america, george bush responds to a question about private contractors, audit finds u.s. hid actual cost of iraq projects, contractors in iraq ma...
Datum: 10.06.2008 16:00 •
Größe: 20.9 MB
story links: Blackwater, Representative Waxman on Blackwater, DynCorp, KBR private contractor job listings, Army Pay 2007, Additional figures on security contractors, Council on Foreign Relations, memo to Oversight Committee October 1st 2007, Co-written by Hal MacDermot
Datum: 09.06.2008 16:00 •
Größe: 14.6 MB
story links: final times for coney island's astroland, music by kris
Datum: 06.06.2008 16:00 •
Größe: 17.9 MB
Immersive composition of looping sounds from the streets of Chinatown.
Datum: 05.06.2008 16:00 •
Größe: 53.5 MB
What is Epistemology?, Thales says Everything is Water, Anaximander says Everything is Air, Rene Descartes, Discourse on the Method of Rightly Conducting One's Reason and of Seeking Truth , Skepticism entry at the Stanford Encyclopedia of Philosophy, The New England Skeptical Society, ...
Datum: 04.06.2008 16:00 •
Größe: 40.5 MB
Rocketboom field correspondent Ruud Elmendorp reports on the story of some 2,000 refugees seeking safety in the Methodist Church in the wake of the recent xenophobic attacks in Johannesburg, South Africa.
Datum: 03.06.2008 16:00 •
Größe: 19.1 MB
How to Siphon Gas from a Newer Vehicle, Paintings by Hitler purchased and remixed, for the show If Hitler Had Been a Hippy How Happy Would We Be, Body Vandals, slam!, Running into the garage door, Kid vs Garage Door, Inner city snail, Painting Chewing Gum revisited, Rome...
Datum: 02.06.2008 16:00 •
Größe: 32.6 MB
Rocketboom Spotlight: 28 Hours of Jyväskylä, a time-lapse film shot in high definition video by Neo Kekkonen in Jyväskylä, Finland.
Datum: 30.05.2008 16:00 •
Größe: 31.7 MB
The Internet Bench from Gdansk, Poland, The Cat Residence, Watching Plants Grow, Watching Pigs Grow, The Church of St. George located Sofia, Bulgaria, the cyber-enabled single crystal X-ray diffraction facility at Case Western Reserve University, Bridge in Umeå, Sweden,...
Datum: 29.05.2008 16:00 •
Größe: 22.8 MB
Rocketboom field correspondent Ruud Elmendorp reports on the rise of anti-immigrant violence in Johannesburg, South Africa.
Datum: 28.05.2008 16:00 •
Größe: 33.8 MB
Story Links: Eating a burger, NASA's Phoenix Lands and is ready to report, Is this the way to Amarillo?, Cold fusion created in labs, Weezer Music Video Meme Pork & Beans, Video Pizza, 1979 performance of Adrian Mumsey's The Lost Sheep, Wearable Motorcycle, Two-wheel Uno...
Datum: 27.05.2008 06:34 •
Größe: 37.5 MB
Story Links: Memorial Day, Henry C Welles, Waterloo, New York, Comparative death rates of selected US wars from 1775 - 2008, Documented civilian deaths from Iraq War, Military and civilian war related deaths through the ages
Datum: 26.05.2008 16:00 •
Größe: 13.1 MB
Story Links: Troops in the Royal Dragoon Guards at the Al Faw base redo Is This the Way to Amarillo? (by Tony Christie and mimed by Peter Kay)
Datum: 26.05.2008 05:40 •
Größe: 31.8 MB
Video response to Andy Warhol eating a hamburger.
Datum: 23.05.2008 08:30 •
Größe: 45.8 MB
Joanne visits Peter Gabriel's human rights video organization Witness.org in Brooklyn, NY.
Datum: 22.05.2008 16:00 •
Größe: 34.7 MB
Story Links: Artist Ben Wilson paints pictures on chewing-gum left on the streets of High Barnet, North London.
Datum: 21.05.2008 18:58 •
Größe: 44.3 MB
Story Links: Muto graffiti animation in Buenos Aires by BLU, Rocketboom field correspondent Jacob Soboroff of Why Tuesday? on today's mail-in primary voting, Study on trust in the US federal government, German speaking Rocketboom field correspondent /SMS ;) speaks with riz khan of Al ...
Datum: 20.05.2008 17:40 •
Größe: 40.5 MB
Story Links: Icahn has Cheeseburger (shareholder but not board member) to overtake Yahoo! board, Yahoo! Board of Directors, Who is your Yahoo Pick?, Moot, 4chan (photo), Jay Maynard, Tron Guy (video, image), Michael Arrington, Techcrunch (photo), Admiral Ackbar, Mon Cala...
Datum: 19.05.2008 08:16 •
Größe: 25.2 MB
Story Links: Rocketboom Spotlight: Super music video, Roll That Stone, in one take with two time frames from The Phoneheads, a drum&bass group from Düsseldorf, Germany. Poor guy never gets to eat.
Datum: 18.05.2008 03:36 •
Größe: 42.7 MB
Story Links: NYC Videoblogging Meetup featuring Jake and Amir. Music by Podington Bear.
Datum: 16.05.2008 01:48 •
Größe: 63.4 MB
Alive In Baghdad reports on the formation of a citizen militia to fight al-Qaeda in the Adhamiya neighborhood of Baghdad, Iraq.
Datum: 14.05.2008 16:00 •
Größe: 46.7 MB
U.S. declares war on Mexico, Mexican-American War, General Ulysses Grant, Stephen Colbert's Birthday, Stephen Colbert for President 2008!, , Democrats revive Internet Freedom and Non-discrimination Act, David Lynch's Daily Weather Report, Foreclosure auction on Michael ...
Datum: 13.05.2008 16:00 •
Größe: 50.2 MB
JFK Air Guitar fetches $5000 on Ebay, The End of Everything, Phoenix to Land on Mars, The National Center for Remote Sensing, Air and Space Law, via Space.com, Red Giants, Kitts Peak National Observatory, Astronomers begin search for 'vanishing' stars, Shuttle Astronaut...
Datum: 12.05.2008 16:00 •
Größe: 25.9 MB
Story Links: Bathtime in Clerkenwell animation by Alex Budovsky, Music: The Real Tuesday Weld with Stephen Coates based on "Sweeter Then Shugar" by the Mills Brothers
Datum: 09.05.2008 19:15 •
Größe: 24.1 MB
Story: International Day of Numbers, Music: Airliner
Datum: 08.05.2008 16:00 •
Größe: 14.3 MB
Rocketboom Kenya field correspondent Ruud Elmendorp investigates malaria prevention in Kenya.
Datum: 07.05.2008 16:00 •
Größe: 29.4 MB
Final ROFLCon video for 2008, Kyle Macdonald of One Red Paperclip talks with Sarah Meyers of Pop17 about his book. Also, help Kyle find out who these guys are at who are these guys dot com. Music from Podington Bear. SEE ROFLCON VIDEO POOL.
Datum: 06.05.2008 23:10 •
Größe: 29.3 MB
Story Links: History of Cinco de Mayo, When Johnny Comes Marching Home by Bonnie Hamilton and The Harmoneion Singers, Ma Petite Biote by Sylvain Piron, El Relicario / Bolero (1927) by The Gonzalez' Orchestra
Datum: 05.05.2008 18:26 •
Größe: 13.6 MB
Joanne meets up with davidjr.com in Union Square, NYC
Datum: 02.05.2008 07:09 •
Größe: 57.2 MB
Story Links: David Weinberger at ROFLcon with a lecture on fame, Music: Flutterbee by Podington Bear.
Datum: 01.05.2008 16:00 •
Größe: 30.3 MB
Jason Scott of Textfiles walks us through a history of online linguistics at ROFLCon 2008, Special appearance by Steve Garfield, Music: Pives and Flarinet by Podington Bear.
Datum: 30.04.2008 16:00 •
Größe: 36.7 MB
Ian Spector of Chuck Norris Facts at ROFLCon, Biographical information about Chuck Norris, The Book about The Truth About Chuck Norris, Chuck Norris sues Chuck Norris Facts, Vin Diesel Facts, Snakes on a Plane at IMDB, Paris Hilton, Lindsay Lohan, Chuck Norris in Delta Force 2, S...
Datum: 29.04.2008 07:00 •
Größe: 44.3 MB
Story Links: Jay Maynard the Tron Guy at the ROFLcon conference, MIT. The classic tron costume page that led everyone awry. Where The Hell Is Matt? Special music thanks to podington bear, ham radio by rtpalovich, Tron on ebay, Tron Arcade, Tron Trailer (redux), Tron (im...
Datum: 28.04.2008 06:50 •
Größe: 30.1 MB
Story: Rocketboom's Andrew Baron captures glass harpist, Alexander Zoltan, on the Charles Bridge in Prague, Czech Republic.
Datum: 25.04.2008 16:00 •
Größe: 39 MB
Story Links: Trojan Horse, NASA awards new lunch services contract to SpaceX, Soyuz TMA-11 goes ballistic , Obamacrombie and Fitch Gate, The REEM-B Robot, Dean Kamen's Slightshot Water Purifier, Pixel Spout, Recycled Cell Phone Art (via Bill Pettit), Cloned Animal Meat C...
Datum: 24.04.2008 16:00 •
Größe: 17.7 MB
Rocketboom Kenya field correspondent Ruud Elmendorp covers the frenzy as Kenyans look to buy shares in state mobile provider Safaricom ahead of their IPO.
Datum: 23.04.2008 16:00 •
Größe: 22 MB
Story Links Happy Earth Day! See Also: RB field correspondent Drew Olanoff dumpster dives for recyclables and Earth Day quotes.
Datum: 22.04.2008 20:00 •
Größe: 19.8 MB
Rocketboom field correspondent Juliette Powell talks with comic book artists Ramon Perez, Mark Brooks, Romain Hugault, and N. Steven Harris at the 2008 New York Comic Con. Music: Sunset Stroll Into The Woods by Podington Bear.
Datum: 21.04.2008 16:00 •
Größe: 27.5 MB
story links: A New York Fairy Tale Continued, Music - Tender & Curious by Poddington Bear
Datum: 18.04.2008 16:00 •
Größe: 41.5 MB
story links: Joanne interviews Shaun Waterford who plans on breaking the world record for most days living underwater.
Datum: 17.04.2008 16:00 •
Größe: 49.3 MB
Encore story links: Interview with Bunker Roy of Barefoot College (thanks, Andrew!)
Datum: 16.04.2008 16:00 •
Größe: 32.1 MB
Story Links: Sark Island changing to democracy, Island sold on Second Life, CBS CEO gets major raise as ratings tumblr, Food Prices Have Doubled or trippled, Reverse evolution may have been witnessed as 2 species turn back into one, Nice looking Phone Watch, Arbor day, D...
Datum: 15.04.2008 23:12 •
Größe: 12.1 MB
story links: Images of the Large Hadron Collider at CERN on Flickr by Zipckr, by TimTom, by Image Editor, Faces of Death nuclear bomb test, Concerned Hawaiians file suit to stop the LHC from blowing up the world, The assassination of John F Kennedy vs The assassination ...
Datum: 14.04.2008 16:00 •
Größe: 23.7 MB
Story: Twitter Madness. Music: Infinity.
Datum: 11.04.2008 19:36 •
Größe: 26.2 MB
story links: Dictionaraoke, Disney movies in 3D, Make magazine's Phillip Torrone covers the creepy new Segway RMP Robot, Poll: 81 Percent Think US on Wrong Track, Osamu Tezuka?s Galaxy Boy Troop puppet space opera of the early 1960's, Seed Magazine interview with Benoit ...
Datum: 10.04.2008 16:00 •
Größe: 19.7 MB
story links: Rocketboom field correspondent Jacob Soboroff talks to computer security expert Ed Felten of Princeton University and Freedom-to-Tinker on the state of electronic voting machines.
Datum: 09.04.2008 16:00 •
Größe: 17.7 MB
story links: Signs of Spring, Inflatable Animals, 6000 sq mile Wilkins Ice Shelf is breaking off, Moderate Resolution Imaging Spectroradiometer, Melting Icecaps may trigger more volcanic eruptions, WWF Paper Dispenser, Hubble finds first organic molecule on extrasolar pl...
Datum: 08.04.2008 16:00 •
Größe: 26 MB
story links: Rocketboom boom mashup by Ronen, Hydrodynamic rotisseries, The Mechanical Beanstalk, 1951 Obituary Index, Jack and the Beanstalk (1952 film), Students challenged to go complaint-free,
Datum: 07.04.2008 17:10 •
Größe: 33.6 MB
Story Links: Joanne hits the streets to look for new videos to watch on YouTube and finds French Kiss New York, Monty Python Philosophy Football, Janet Rocke with U, Janet - Feedback, Kimbo Slice - The heart of a Lion
Datum: 04.04.2008 13:01 •
Größe: 41.5 MB
Story Links: Joanne visits the New Design High School
Datum: 03.04.2008 19:16 •
Größe: 39.7 MB
Story Links Canadian Rocketboom field correspondent Wayne MacPhail covers the Alien Abduction Festival
Datum: 03.04.2008 05:26 •
Größe: 42 MB
Story Links: Alien found on the beach, Water on Mars, Looking for dark matter on the South Pole, Rick Roll direct link
Datum: 01.04.2008 16:43 •
Größe: 6.8 MB
Story Links: Earth Hour, Automatic Dance machine, John Edwards continues to make no endorsement, John Edwards on Rocketboom, Romanian Poet Nichita Stanescu was born today, President Lyndon B. Johnson announces he will not run for re-election today, Obama and Clinton cont...
Datum: 31.03.2008 16:06 •
Größe: 27.7 MB
Story Links: Save the world from Magibon, Rocketboom, Lisa Nova, Ze Frank, Revision3, Podshow, Make your scene in seconds with Bombay.tv
Datum: 31.03.2008 03:57 •
Größe: 20.7 MB
Story Links: Reggie Watts (music) | Extra: Check back for Saturday episode in Mumbai.
Datum: 28.03.2008 17:23 •
Größe: 24.3 MB
story links: Motorcycle Airbags, Motorcycle Airbags v1.0, Creepy Virtual Woman, Creepy non-Virtual Magibon, Twitter Marriage Proposal, Twitter Marriage Acceptance, Proof of Twitter Marriage Acceptance Engagment Ring, The First Twitter Marriage Proposal, The First Twitte...
Datum: 27.03.2008 16:00 •
Größe: 26.6 MB
Story Links: The Shama?iya district in far east Baghdad is currently undergoing a major sewage disaster as polluted water fills the streets, and permeates the air. Field Report by Alive in Baghdad.
Datum: 25.03.2008 05:03 •
Größe: 109.5 MB
Story Links: Potato, The Potato Song, The United Nations declares 2008 International Year of the Potato, The World Potato Congress Incorporated Organization to meet in Christ Church New Zealand in 2009, February 54th is Day of The Potato
Datum: 25.03.2008 04:58 •
Größe: 21.6 MB
Story Links: NYC Union Square Pillow Fight 2008 (music) See Also: Pillow Fight 2007, Pillow Fight 2006
Datum: 25.03.2008 04:19 •
Größe: 66 MB
Story links: George Bush speaks at the NYC Economic Club, Joseph Stiglitz, Common trends for time travelers to Germany (via Metafilter), German gas prices reach over $8US per gallon, Dick Cheney disregards public opinion, Stiglitz is expecting $4 trillion needed to resto...
Datum: 24.03.2008 15:42 •
Größe: 41.3 MB
Story Links: Rocketboom New York City Music Video Week. Joanne visits the first morning of Spring (music).
Datum: 21.03.2008 15:36 •
Größe: 22.4 MB
story links: Rocketboom New York City Music Video Week. Joanne visits The Orchid Show at the New York Botanical Garden in The Bronx, NY.
Datum: 20.03.2008 22:00 •
Größe: 35.1 MB
story links: Rocketboom New York City Music Video Week. The Elephants arrive in New York.
Datum: 19.03.2008 22:00 •
Größe: 39.8 MB
Story Links: Rocketboom New York City Music Video Week. Encore: Joanne travels across New York City backwards through time. Eclipse Solaire by vinc2-exoplanete (music)
Datum: 19.03.2008 03:45 •
Größe: 38.1 MB
Story Links: Rocketboom New York City Music Video Week. Miniature City. Inspired by Little People. Music by Drew.
Datum: 18.03.2008 16:28 •
Größe: 27.2 MB
Story: Rocketboom New York City Music Video Week. Fire Escape. Music by PQPiano3
Datum: 17.03.2008 15:07 •
Größe: 35.5 MB
story links: I Can Has Cheezburger founder Eric Nakagawa and CEO Ben Huh discuss the LOLcats phenomenon during the LOLWUT? panel at the 2008 SXSW Interactive Festival.
Datum: 14.03.2008 16:00 •
Größe: 29.2 MB
Story links: Battledecks contestants improvise conference presentations from previously unseen powerpoint slides. Jeff Tidwell is the moderator. Judges include Erika Hall and Jonathan Grubb. Contestants include George Kelly, Ted Rheingold, Rob Weichert, Jon Armstrong and Anil Das...
Datum: 13.03.2008 15:04 •
Größe: 33.3 MB
story links: Rocketboom Spotlight: Salvador Dali and Gala
Datum: 12.03.2008 16:00 •
Größe: 11 MB
Interview with Austin artist, Steve Brudniak and his latest art work which will be carried to the the International Space Station by private citizen and game developer Richard Garriot.
Datum: 11.03.2008 15:29 •
Größe: 38.3 MB
This scene might look like a crowd of people leaving a lacy keynote but it's just the beginning of wonderful things to come from SXSW in Austin, Texas. Such as, I CAN HAS CHEEZBURGER. Stay tuned for more than your normal releases this week.
Datum: 10.03.2008 15:00 •
Größe: 18.5 MB
story links: New York City 1911-Present, by Adam Quirk of Wreck and Salvage, NYPL Digital Gallery, video of the Empire State Building, music by Dosh
Datum: 07.03.2008 17:00 •
Größe: 25.4 MB
story links: Rocketboom's Ellie Rountree visits Toy Tokyo in New York City.
Datum: 06.03.2008 17:00 •
Größe: 30 MB
story links: Avalanche on Mars, Human Pole Position, Kanye Hands, Moses was on psychedelics, H.R. Pufnstuf, Bush and Cheney wanted for Crimes Against our Constitution, How To Write Humor, Hamburger Dress, Bayonets Thrust into Snow Man by Soldiers at Practice, Easy Do-It-...
Datum: 05.03.2008 17:00 •
Größe: 17.5 MB
story links: RB Field correspondent Steve Garfield interviews Paul Gurspan of Special Project Management on recycling construction waste in Boston.
Datum: 04.03.2008 17:00 •
Größe: 64.8 MB
story links: Princes of Antioch, Organ Donor Cards, Intellectual Property Donor Card, Fail Dogs, Unexplained Force Objects, Chaos Theory, Robert Scoble on FastCompany.tv, Longplayer plays without repetition for over 2984 days
Datum: 03.03.2008 17:00 •
Größe: 27.5 MB
story link: Ransom.
Datum: 29.02.2008 17:00 •
Größe: 38.8 MB
story links: artist Brian Feldman celebrates Leap Year Day.
Datum: 28.02.2008 17:00 •
Größe: 66.2 MB
story links: Rocketboom Spotlight: Andy Warhol
Datum: 27.02.2008 17:00 •
Größe: 16.1 MB
story links: stick-on-eyes, deli-packaged whole human, rinspeed amphibious sports car, 1930's movie theater of the future, plant-to-twitter plugin, 867-5309 wiki, Ransome, The Epoch of Ptolemy's Nabonassar, ????? ???, Disco Bambina
Datum: 26.02.2008 17:00 •
Größe: 15.7 MB
story links: Brain control gaming headset, Ralph Nader to run for president again, iBand, Entramado, Camouflage photography (via), Stars in Your Lap, with Joanne, Alex Albrecht of Diggnation, Xeni Jardin and Mark Frauenfelder from Boing Boing and Ze Frank, Earth to meet with fi...
Datum: 25.02.2008 17:00 •
Größe: 14.7 MB
story links: Paul Dateh (aka the Hip-Hop Violinist) interprets Joanne's day.
Datum: 22.02.2008 17:26 •
Größe: 26.1 MB
story links: Footage from the February 20-21 2008 total lunar eclipse captured with a Red One digital camera. (thanks, Ian!) More to come later.
Datum: 21.02.2008 17:18 •
Größe: 495 KB
story links: interview with perfumist Douglas Hopkins on the art and science of perfume.
Datum: 20.02.2008 16:54 •
Größe: 46.4 MB
Interview with multimedia production company MediaStorm. For extended interview with Brian Storm, see part II [flash|mov|wmv]
Datum: 19.02.2008 18:13 •
Größe: 23.3 MB
Story Links: Magibon, Dramatic Lemur, Big Black Staring Contest, Charlie Chaplin Table Ballet, Fat Cat on Couch, 4:33 by John Cage, The Pirate Mime
Datum: 18.02.2008 17:01 •
Größe: 29.3 MB
Story Link: Talk:The Ransom
Datum: 15.02.2008 16:50 •
Größe: 11.7 MB
Happy Valentine's day from the vegetables.
Datum: 14.02.2008 15:41 •
Größe: 30.8 MB
Story Links: Rocketboom field correspondent Ruud Elmendorp reports from Kenya on the status of the election crisis. For more information see the Rocketboom wiki on Kenya.
Datum: 13.02.2008 16:31 •
Größe: 33.7 MB
Story Links: Happy 199th birthday to Charles Darwin, Evolution, animation in collaboration with Adam Quirk of Wreck and Salvage
Datum: 12.02.2008 20:28 •
Größe: 37.7 MB
Story links: Anonymous stages protests against the Church of Scientology in cities around the world. Rocketboom field correspondents covered the event Andy Carvin - Washington D.C., Steve Garfield - Boston, John Coffey - Philadelphia, Juliette Powell - New York City, Neutral News...
Datum: 11.02.2008 19:38 •
Größe: 51.3 MB
Story Link: Joanne interviews Jamie O'Shea on his experience traveling through an artificial time warp.
Datum: 08.02.2008 19:15 •
Größe: 47.7 MB
Story Links: Know Your Meme, What ever happened to Corey Worthington Delaney and his Famous Glasses?, Cory Delaney's fame attributed to A Current Affair and Tonight Today Australian TV programs, I Like Turtles, I like Turtles Kid Speaks out about why he likes Turtles, Mo...
Datum: 06.02.2008 09:58 •
Größe: 19.6 MB
Story Links: Rocketboom field correspondent and The Uptake producer Chuck Olsen covers the religious, back-country vote of Tennessee.
Datum: 06.02.2008 09:35 •
Größe: 49.8 MB
Story links: Leap Year, Improv Everywhere's Frozen in Grand Central Station, Noisy New York Superbowl roar (fan images), Patriots accused of cheating by US senate (Thanks, Gary V and Bill D!), Patriots Quarterback Tom Brady poses as Tom Brady from the Brady Bunch (via), Internet...
Datum: 05.02.2008 03:00 •
Größe: 38.4 MB
Story Link: pi
Datum: 01.02.2008 15:34 •
Größe: 27.4 MB
Story links: Rob Malda a.k.a. CmdrTaco, Slashdot, Images Credits (1, 2, 3, 4, 5, 6), Idle, New York Times on Wisdom of the Crowds, Digg changes algorithm, Cheeseburger in a can (via), Reddit, Hard road ahead for Fox News, They, Gamera, Andy Plesser of Beet.TV interview w...
Datum: 31.01.2008 23:55 •
Größe: 34.6 MB
Story: Alive in Baghdad on the state of gold in Iraq
Datum: 30.01.2008 21:10 •
Größe: 44.8 MB
Story Links: The Moon, Lunar Registry, Moon Treaty, International Waters, Antarctica, International Space Law, Moon Energy, Helium-3
Datum: 29.01.2008 16:17 •
Größe: 23.7 MB
Story Links: Ludolph van Ceulen of Fildesheim Germany calculated Pi to 35 places, Pi Song, Simulation of Astroid attacking Dianasours, Nick Denton of Gawker attacks Church of Scientology (Photo by Dave Winer), Anonymous threatens Scientologists, YouTube Prince Mr. Feth p...
Datum: 28.01.2008 16:42 •
Größe: 36 MB
Story: Where lost socks go
Datum: 26.01.2008 05:07 •
Größe: 43 MB
Story Links: The search for a good pot dealer, Robot in Japan controlled by monkey in US, Watching paint dry, Paint dry watching expert, Hardcore paint drying, Wikiboom collection of paint drying videos, Historical party in Melbourne with Corey Delaney and his famous sun...
Datum: 24.01.2008 17:33 •
Größe: 31.1 MB
Story Links: Rocketboom field correspondent Ruud Elmendorp reports from Kenya. For updates, links and ways to help, see the Rocketboom Wiki on Kenya.
Datum: 24.01.2008 02:04 •
Größe: 44.3 MB
Story Links: Rocketboom field correspondent Ruud Elmendorp is stationed in Kenya and continues to release more reports on the crisis. Additional footage and updates on the Rocketboom Wiki.
Datum: 23.01.2008 18:19 •
Größe: 38.4 MB
Rocketboom Interview with Gary Vaynerchuk of Wine Library TV, Wine Library TV interview with Rocketboom
Datum: 22.01.2008 19:57 •
Größe: 50.6 MB
story links: a world of lp portraits (inspired by the flickr group LP Portraits)
Datum: 18.01.2008 17:52 •
Größe: 31.1 MB
Story Links: Joanne interviews Gizmodo's Richard Blakeley who used the TV-B-Gone remote control to make a video of himself turning off TV's during presentations at the 2008 CES conference in Las Vegas, [Photo Credits: (1) by Brian Solis, (2) by jonl,] | Extra: Ongoing Ro...
Datum: 17.01.2008 18:44 •
Größe: 78.1 MB
Rocketboom Kenya field correspondent Ruud Elmendorp uncovers the effect of post election instability on regional tourism.
Datum: 17.01.2008 01:52 •
Größe: 39.1 MB
Rocketboom Kenya field correspondent Ruud Elmendorp covers displaced villagers in Nakuru
Datum: 16.01.2008 19:39 •
Größe: 45.9 MB
Story Links: The Social Construction of Reality, Apple is in the air, LP portrait record collection flickr pool, Jamie O'shea still travels slowly through time, Ubuntu Ruby Tutorial, NASA's Hubble finds Double Einsteing Ring, Superelectronic (via), Superbad, Jodi.org, Su...
Datum: 15.01.2008 16:58 •
Größe: 27.9 MB
story links: Jamie O'Shea is locked in a 3:2 time box for 3 weeks, Delay Pedal, Rabbits in Prison, Asteroid Nears Mars, Tokyo Stormtrooper, Japan's Minister of Defense believes in UFOs
Datum: 14.01.2008 17:01 •
Größe: 38.6 MB
Story Links: Rocketboom Spotlight: RJD2 - Work It Out directed by Joey Garfield with Ghost Robot.
Datum: 13.01.2008 21:54 •
Größe: 51.8 MB
story links: Lake Chargoggagoggmanchauggagogg- chaubunagungamaugg, Krungthepmahanakornamornratanakosinmahintarayutthayamah - adilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit, Principality of Sealand and Order of...
Datum: 10.01.2008 19:44 •
Größe: 24.2 MB
A day in the life of independent coverage of the U.S. Presidential Elections: RB field correspondents Chuck Olsen and Steve Garfield cover the primaries for The Uptake as RB field correspondent Jacob Soboroff promotes election reform with WhyTuesday?
Datum: 09.01.2008 16:26 •
Größe: 47 MB
Story Links: Rocketboom field correspondent Ruud Elmendorp covers the lead-up to the election violence in Kenya.
Datum: 08.01.2008 20:32 •
Größe: 34.3 MB
story links: King Alfonso of Portugal, A woman was spotted yesterday reading today's paper, Solar Cycle #24 begins, Fox Business News Network watched by only 6,300 people per day at any give time (example video), Jay Leno back on TV without his writers, Classic Tootsie R...
Datum: 07.01.2008 16:54 •
Größe: 30.1 MB
Story Links: Rocketboom Spotlight: New York Airplane Flight by Sam Fuller
Datum: 05.01.2008 10:21 •
Größe: 16.8 MB
story links: Game Boy Around the World, The rise and fall of Hello Kitty Hell, Twitter list of prediction lists, Ask Bill Gates at CES, Apple to take over world in 2008, Robert X. Cringely's wackywise predictions, Don't censor me "worst comments on digg" aggregator, Asse...
Datum: 03.01.2008 16:52 •
Größe: 17 MB
story links: Know Your Meme, DeAndre Ramone Way aka Soulja Boy Tell'em, Crank That music video, How to Crank That instructional dance video
Datum: 01.01.2008 05:18 •
Größe: 12.5 MB
story links: Know Your Meme, Adam Nyerere Bahner a.k.a Tay Zonday, Chocolate Rain, Tay Zonday on Jimmy Kimmel, Chad Darth Tay Zonday Vader , McGruff the Tay Zonday Crime Dog, Vanilla Snow, Cherry Chocolate Rain Dr. Pepper
Datum: 28.12.2007 10:11 •
Größe: 20.6 MB
story links: Know Your Meme, Charlie the Unicorn, Britney Spears on MTV 2007, Chris Crocker Leave Britney Alone reaction video, Seth Green Leave Chris Crocker Alone video, Perez Hilton Leave Me Alone video, Britney Spears impersonator responds to Leave Chris Crocker Alone video, ...
Datum: 27.12.2007 09:56 •
Größe: 14.5 MB
story links: Know Your Meme, Dramatic Prairie Dog, lolrus, Dramatic Chipmunk vs Dramatic Prairie dog on Google Trends, Japan's Mini Moni on Hello! Morning - original source of the Dramatic Prairie Dog, Drama Prairie Dog on Encyclopedia Dramatica, Collection of videos of ...
Datum: 26.12.2007 11:27 •
Größe: 5.4 MB
story links: Know Your Meme, Technoviking parade, Technoviking with subtitles, Technoviking on Michael Jackson's Beat It! (via), Technoviking Cranks Dat ytmnd, Lolcat Technoviking, Vote for Technoviking
Datum: 24.12.2007 16:13 •
Größe: 15.7 MB
story links: Know Your Meme, LOLCats, I can has cheeseburger, Make your own LOLCat Pics, LOLcode, History of according to Anil Dash, LOL reference links
Datum: 21.12.2007 18:22 •
Größe: 7.1 MB
story links: Know Your Meme, Miss Teen USA South Carolina answers a question, Miss Teen USA South Carolina answers a question (with subtitles), What's really going on up there?, Miss Teen South Carolina Calls 911, Miss Teen South Carolina in front of Rocketboom map mashu...
Datum: 20.12.2007 16:25 •
Größe: 8.8 MB
story links: Know Your Meme, I Like Turtles, Trained Turtle, Turtles Megamix Music Vid, Floating Turtles Remix, I Like Turtles kid explains why he said I like turtles, Tay Zonday I like Turtles mashup, More videos with Ellie from Rocketboom
Datum: 19.12.2007 16:04 •
Größe: 11.7 MB
story links: Rocketboom Holiday Episode Know Your Meme - Rick Roll, #1 BEST VIDEO EVER! CLICK HERE!!, Rick Astley's Never Gonna Give You Up, What the F! bomb, Duckroll, The first Rickroll YTMND, Formal definition of Rickroll & Various extensions and mashups of the Rickr...
Datum: 18.12.2007 18:00 •
Größe: 13.6 MB
story links: Rocketboom Holiday Episode Know Your Meme - One Take, Dafthands, Daft Bodies, The Way Things Go, Ok Go!, Flagpole Sitta Lipdub
Datum: 18.12.2007 00:59 •
Größe: 24.2 MB
Joanne interviews Robert Tolmach of Changing The Present
Datum: 15.12.2007 07:32 •
Größe: 34.8 MB
story links: Bucketroom mashup (thanks, Ronen!), Animal rights activists call for the end to the NYC Horse and Carriages (image credits: 1, 2, 3, 4), NASA STS-122 space shuttle mission to the ISS rescheduled for January, M-430iA Series Food and Pharmacetutical Robot, J. ...
Datum: 13.12.2007 16:48 •
Größe: 28.6 MB
Rocketboom field correspondent Bre Pettis makes a secret compartment book for make.
Datum: 12.12.2007 21:35 •
Größe: 41.3 MB
story links: Interview with Lauren Cornell on Rhizome.org and new New Museum of New York City
Datum: 12.12.2007 03:38 •
Größe: 18.8 MB
story links: International Human Rights Day, The 25th anniversary of The Commodore 64, 139th birthday of the first traffic signal, The Beard and Mustache Knitted Face Cap, More cities add LED's to holiday displays, LED X-mas lights for sale online, Vote for Chris Christm...
Datum: 10.12.2007 17:00 •
Größe: 31.4 MB
Joanne surveys the winter dogs of New York City.
Datum: 08.12.2007 02:02 •
Größe: 18.4 MB
story links: tibet, the roof of the world, the himalayas, mount everest, the rest of everest podcast, what is buddhism, potala palace, the tibetan flag, conflict over tibetan independence, tibet's government in exile, the 14th dalai lama of tibet, the 13 previous dalai...
Datum: 06.12.2007 17:35 •
Größe: 31.8 MB
Story Links: Rocketboom field correspondent Ruud Elmendorp covers Michael Mutuku from de Dandora Nairobi campaigning for city councillor. Extra: Happy Hanukkah Matzah Ball Madness from Washington D.C. Rocketboom field correspondent Andy Carvin.
Datum: 05.12.2007 19:01 •
Größe: 67.7 MB
Rocketboom interview with Garrison Keillor of Prairie Home Companion
Datum: 04.12.2007 15:27 •
Größe: 39.6 MB
story links: (episode #800)Fastest clapper in the world (video), clap on clap off clapper commercial, PC Clapper, Ascii Generator, This year vote for Chris Christmas Rodriquez to replace Santa, Christmas tree lights to Trans-Siberian Orchestra's "Wizard in Winter, Rockef...
Datum: 03.12.2007 15:45 •
Größe: 29.8 MB
Republicans at their best answer YouTube user submitted video questions for the CNN YouTube Republican Debate
Datum: 30.11.2007 20:56 •
Größe: 31.7 MB
story links: rb field correspondent ryan estrada visits la mina club in zacatecas, zacatecas, mexico
Datum: 29.11.2007 17:00 •
Größe: 10.9 MB
story links: rocketboom field correspondent ruud elmendorp reports on raphael obongo and the miss koch youth group in nairobi, kenya
Datum: 28.11.2007 17:00 •
Größe: 38.7 MB
story links: joanne interviews tim westergren, founder of pandora radio.
Datum: 27.11.2007 17:02 •
Größe: 59 MB
story links: ludwig wittgenstein, etiquette in the middle east, use your thumb to point in indonesia, use your chin in honduras, maneki neko, buddhism in a nutshell, hamsa hand, william "dummy" hoy, chinese opera hand gestures, american sign language, swedish sign langua...
Datum: 26.11.2007 17:00 •
Größe: 30.8 MB
Whats really going on at the Macy's Thanksgiving Day Parade. See also, The Bluies vs. The Peachies, The Imperial March
Datum: 21.11.2007 16:51 •
Größe: 62.6 MB
story links: Sumo Akebono vs. bodybuilder Geroege Farah, Ship bow Photoshop, Crayon Physics Deluxe, Decoding your DNA, dfgtuvsdigvofdhdfsohijdfhnidsghfdsiugdghoiidfougdfsghfgyrtdrg.com expired, HD Earthrise and an Earthfall, Procrastination Chart, Battleship, 10Questions...
Datum: 20.11.2007 16:42 •
Größe: 14.4 MB
story links: Saturday Night Live kaput?, old guard internet writers, old school internet designers, Jed's Other Poem (Beautiful Underground), Not the Daily Show, Not the Colbert Report (video), Astronomers Journey Halfway Around the World to Study Five-Minute Spectacle, ...
Datum: 19.11.2007 16:48 •
Größe: 39.6 MB
story links: rocketboom visits rooftop legends at the new design high school in new york city. (music: pianissimo by flatlink)
Datum: 16.11.2007 17:00 •
Größe: 15.4 MB
story links: perpetual motion is finally real, revolutionary new telephone technology from 1969,
karnaughcalc (via apple recent webapps), recent headlines on the recent strikes: writers' strike affecting campaigning for oscars, hollywood writers strike based on fear, th...
Datum: 15.11.2007 17:00 •
Größe: 30.1 MB
story links: rocketboom field correspondent bre pettis (and actiongirl) shows us how to make a rubik's cube out of dice.
Datum: 14.11.2007 17:02 •
Größe: 51 MB
story links: joanne explores the present future of politics with andrew rasiej, micah sifry and josh levy of 10Questions.com
Datum: 13.11.2007 17:00 •
Größe: 28.9 MB
story links: PetroChina becomes world's first trillion dollar company, Chessboxing, The Radio Hat, Joanne Hello Kitty Hell, Chris Langen smartest person in America (video interview), Take an IQ Test for yourself online now, New Russian spacecraft on the way (video of Spu...
Datum: 12.11.2007 20:25 •
Größe: 32.4 MB
Datum: 09.11.2007 20:41 •
Größe: 36.5 MB
story links: rb field correspondents alive in baghdad covers the celebration after the iraqis win the 2007 asia cup. (help support alive in baghdad)
Datum: 08.11.2007 18:34 •
Größe: 58.7 MB
story links: rb field correspondents alive in baghdad profile workers of the facilities protection service at the ibn al-nafees hospital in baghdad, iraq (help support alive in baghdad)
Datum: 07.11.2007 17:00 •
Größe: 52.8 MB
story links: social network geographical map, Rocketboom on MySpace, Rupert Murdock purchased MySpace for $580 Million, Rocketboom on YouTube, Joanne on Facebook, Microsoft buys Facebook crumb for $240 Million, Facebook worth $15Billion?, Google vs Microsoft over Faceboo...
Datum: 06.11.2007 17:39 •
Größe: 37.9 MB
story links: tokyo dance trooper 1 & 2, will don come back?, echoes from the moon, the WGA goes on strike, breaking news in the diet pepsi and mentos meme, the politics of parsing, google open social hacked, facebook valuation, myspace comeback, fictional wwii light tran...
Datum: 05.11.2007 17:00 •
Größe: 49.5 MB
Joanne goes for a bicycle ride through Manhattan.
Datum: 02.11.2007 18:30 •
Größe: 35.5 MB
2007 Annual New York City Halloween Parade
Datum: 01.11.2007 23:37 •
Größe: 62.3 MB
Story Links: bonfire, Chinese lanterns, dinner, Stonehenge, Day of the Dead, French graveyard, pentacle, Egypt, Hell, Pope, voodoo, Baron Samedi laughing on train, Baron Semedi commercial, Special Thanks to Abracadabra for generously loaning the costumes to Rocketboom
Datum: 31.10.2007 17:25 •
Größe: 24 MB
Story Link: Joanne interviews Shakespeare Company Theater Artistic Director Michael Kahn on the new Harmon Center for the Arts theater in Washington D.C. [music by Two Violins
Datum: 30.10.2007 16:42 •
Größe: 59.5 MB
Story Links: Lungfish, Lungfish thought to see in color, (image 1, image 2), Human race will split into two different species according to Oliver Curry, New York City Zombie Walk, NASA expands International Space Station, iPhone Costume Halloween 2007, Fox News links Al Queda ...
Datum: 29.10.2007 17:01 •
Größe: 29.6 MB
Story Link: Archives.
Datum: 26.10.2007 20:00 •
Größe: 36.2 MB
story links: Robot Monster, B-Movies Archive, Indian Michael Jackson Thriller Chiru, World Record attempt for most simultaneous Michael Jackson Thriller dances, Maker Faire Video Set, The Knitting Drummer, Ron Paul mention on Rocketboom, China in Orbit on way to Moon, No menti...
Datum: 25.10.2007 17:25 •
Größe: 42.8 MB
story links: rocketboom field correspondent juliette powell attends the legal defense fundraiser for graffiti artist 2ESAE at eyebeam in new york city.
Datum: 24.10.2007 16:00 •
Größe: 16.1 MB
story links: Liquid Bendy, Log Riding Championship of the World, Ippon Nori is a ride on a log, The Ladder Climb, South Korean Fans, Bogsnorklers, Jump Rope Champions, 2007 French Downhill Championship, Beatbox Battle, 2007 Folding bike Brompton World Championship, Nordic Cham...
Datum: 23.10.2007 18:37 •
Größe: 37.9 MB
story links: Rocketboom and Sarah Meyers covers Maker Faire 2007 Austin, Texas (Extra/Extended Video Set)
Datum: 23.10.2007 17:21 •
Größe: 34.9 MB
story links: 'devil-angel 1' created by chris cole and joanne colan
Datum: 19.10.2007 16:00 •
Größe: 37.1 MB
story links: Blackwater, Representative Waxman on Blackwater, DynCorp, KBR private contractor job listings, Army Pay 2007, Additional figures on security contractors, Council on Foreign Relations, memo to Oversight Committee October 1st 2007
Datum: 18.10.2007 16:37 •
Größe: 14.6 MB
Story Links: Rocketboom field correspondent Steve Garfield checks out the Chevy Volt next-generation electric car.
Datum: 17.10.2007 16:00 •
Größe: 66.3 MB
Story Link: Joanne interviews Matthew Danzico of Around America in 2.0 about his free travels across the country.
Datum: 16.10.2007 15:47 •
Größe: 44.1 MB
story links: Radiohead pay-what-you-wish record sales, Star Wars trumpet girl, Allen Telescope Array, Techno Viking with captions, Superman reverse Moon transit, Hitler Banned From iSketch, Myriam Laplante's Lupus in Fabula (via), Planet Hiltron, El Patito Feo -The Ugly Duckli...
Datum: 15.10.2007 14:43 •
Größe: 25.7 MB
story links: William Wegman and Roxy Paine at Shake Shack in Madison Square Park
Datum: 12.10.2007 18:01 •
Größe: 35.5 MB
story links: 1582 missing records, 2007 Rubix Cube champion Yu Nakajima, one handed Rubix Cube champion Dan Dzoan, blindfolded Rubix Cube champion Chris Kruger, how to cube blindfolded, wall-mart spread (via), baby moving inside belly videos, Porridge making champion of the wo...
Datum: 11.10.2007 15:41 •
Größe: 32.3 MB
story links: Avatar Man, invisible cloak, motion capture, 3D facial animation with expression detail mapping, color based object tracking, Eyesweb tracking software, motion tracking home test, Tony Hawk motion capture for skateboarding game, motion capture suit, Wayne Rooney c...
Datum: 10.10.2007 15:28 •
Größe: 27 MB
story links: Rocketboom field correspondent Ruud Elmendorp covers the Kitale Nature Conservancy for handicapped and genetically mutated animals in Kenya
Datum: 09.10.2007 17:35 •
Größe: 21.3 MB
story links: First person shooter Avatar Man (via pixelsumo, see also: First Person Shooter by Blake Fall-Conroy), French urban Olympic training, 13-year student Johnny Lechner live cam, Appendix with a purpose, Instant Baby Machine, Human creation of life announcement expecte...
Datum: 07.10.2007 20:30 •
Größe: 21.2 MB
story link: rocketboom nyc field report by davidjr
Datum: 05.10.2007 16:00 •
Größe: 52.7 MB
story links: boingboing tv, the plastic infinite, burble, burble london, wiimbledon on rocketboom, retiree wii bowling tournament, wii bowling championship match, retirement living tv, walter cronkite the comeback kid, transparent frogs, a real invisibility cloak, a fake invis...
Datum: 04.10.2007 16:00 •
Größe: 16.6 MB
story: Free Burma
Datum: 04.10.2007 10:04 •
Größe: 3.3 KB
Rocketboom Field Correspondent Bre Pettis on how to make a mellotron
Datum: 03.10.2007 15:38 •
Größe: 47.9 MB
story links: Myanmar (Burma), UN Human Development reports, Demonstrations of 1988, Aung San Suu Kyi, Monks killed and left in jungle, Country shuts down internet, Jim Carry, using satellite imagery to track atrocities, Facebook group for world-wide action (oct 6), free burma ...
Datum: 02.10.2007 16:21 •
Größe: 26 MB
story links: Alexander the Great defeats Darius III of Persia in the Battle of Gaugamela, John XIII becomes Pope, Nguyen Hue declares himself emperor of Vietnam, top viewed YouTube videos for today, Naruto Shippuuden, non animated animation, iPhone unlocked and hacked, Apple w...
Datum: 01.10.2007 15:51 •
Größe: 38.6 MB
story link: it's jerry time
Datum: 28.09.2007 14:57 •
Größe: 55.3 MB
halo3 images (1, 2, 3), dawn launch, bangkok market train, hair dryer revolver, walking the fish, nerd auction, worshiping the purdue engineering Fountain flash mob, all atari video by golden shower, rocketboom minnesota field correspondent chuck olsen covers digeredoo brain m...
Datum: 27.09.2007 15:13 •
Größe: 33.2 MB
story links: rocketboom special field correspondent jacob soboroff of covers the vote from colonial america
Datum: 26.09.2007 22:39 •
Größe: 95.6 MB
story links: rocketboom field correspondent ruud elmendorp covers the international criminal tribunal of rwanda in tanzania
Datum: 25.09.2007 16:47 •
Größe: 32.7 MB
story links: muhammad completes hegira from mecca to medina, nasa prepares dawn for destination to astroid belt, pluto off course, orgosolo's ballo sardo sardinien, mayor bloomberg denies trade center access to iranian president, new bubble wrap technology (via), i take a pict...
Datum: 24.09.2007 16:00 •
Größe: 47.8 MB
story links: one web day, interview with founder of one web day, one web day wikiboom answer page, rocketboom music mashup by radioscopic
Datum: 22.09.2007 01:04 •
Größe: 36.9 MB
story links: one web day, interview with founder of one web day, one web day wikiboom answer page, rocketboom music mashup by radioscopic
Datum: 21.09.2007 23:04 •
Größe: 36.9 MB
story links: the woman saw the girl with a telescope, young woman old woman illusion, buffalo buffalo buffalo buffalo buffalo buffalo buffalo buffalo, no car day in china, lion-eating poet in the stone den, the latest oldest person in the world, the horse raced past the barn ...
Datum: 20.09.2007 15:29 •
Größe: 19.6 MB
story links: the woman saw the girl with a telescope, young woman old woman illusion, buffalo buffalo buffalo buffalo buffalo buffalo buffalo buffalo, no car day in china, lion-eating poet in the stone den, the latest oldest person in the world, the horse raced past the barn fell, car lifted by fir...
Datum: 20.09.2007 13:29 •
Größe: 19.6 MB
story links: rb field correspondent bre pettis from make magazine shows us how to make a foxhole radio, hollywood now with joanne colan on paltalk.com
Datum: 19.09.2007 16:00 •
Größe: 55 MB
story links: rb field correspondent bre pettis from make magazine shows us how to make a foxhole radio, hollywood now with joanne colan on paltalk.com
Datum: 19.09.2007 14:00 •
Größe: 55 MB
story links: flying polar robot, arctic sea route opens after ice melts, amazing wall animation by blu, humans responsible for climate change, bush or chimp, world conservation union red list, warm dark matter and stars
Datum: 18.09.2007 16:00 •
Größe: 20.5 MB
story links: flying polar robot, arctic sea route opens after ice melts, amazing wall animation by blu, humans responsible for climate change, bush or chimp, world conservation union red list, warm dark matter and stars
Datum: 18.09.2007 14:00 •
Größe: 20.5 MB
story links: happy birthday to linux, the computer and communications industry association, fair use report, apple blocks non-itunes software use with ipod, apple ipod block checksum cracked, rockbox linux ipod firmware, one web day (video interview with founder), one web day ...
Datum: 17.09.2007 15:04 •
Größe: 30.9 MB
story links: happy birthday to linux, the computer and communications industry association, fair use report, apple blocks non-itunes software use with ipod, apple ipod block checksum cracked, rockbox linux ipod firmware, one web day (video interview with founder), one web day wikiboom, obstruction r...
Datum: 17.09.2007 13:04 •
Größe: 30.9 MB
story links: rb field correspondent juliette powell visits the burning man festival at the black rock desert in nevada. (extended video set)
Datum: 14.09.2007 15:35 •
Größe: 59.7 MB
story links: rb field correspondent juliette powell visits the burning man festival at the black rock desert in nevada. (extended video set)
Datum: 14.09.2007 13:35 •
Größe: 59.7 MB
story links: 8.4 earthquake strikes southern sumatra, britney fan, zombocom, sarah meyers at fashion week, drum pants, transforming clothing, X Prize goes to Moon, harry potter films on top, ice cream machine
Datum: 13.09.2007 16:37 •
Größe: 30.3 MB
story links: 8.4 earthquake strikes southern sumatra, britney fan, zombocom, sarah meyers at fashion week, drum pants, transforming clothing, X Prize goes to Moon, harry potter films on top, ice cream machine
Datum: 13.09.2007 14:37 •
Größe: 30.3 MB
story links: rb field correspondent stefan sydel sms ;) covers the 2007 ars electronica festival in linz, austria, the tallest lego tower ever built, japanese plan the world's tallest building, the longest list of the longest stuff at the longest domain name at long last dot c...
Datum: 12.09.2007 16:00 •
Größe: 33.4 MB
story links: rb field correspondent stefan sydel sms ;) covers the 2007 ars electronica festival in linz, austria, the tallest lego tower ever built, japanese plan the world's tallest building, the longest list of the longest stuff at the longest domain name at long last dot com, the longest buildin...
Datum: 12.09.2007 14:00 •
Größe: 33.4 MB
george bush on september 11th being told the second tower had been hit
Datum: 11.09.2007 16:25 •
Größe: 74.6 MB
george bush on september 11th being told the second tower had been hit
Datum: 11.09.2007 14:25 •
Größe: 74.6 MB
story links: don alonso perez de guzman el bueno, remote control skates, joanne's hollywood now show on pal talk (extended paltalk interview (quicktime, windows media), x-hawk flying car (via), ochi 'dainoji' yosuke world air guitar champion (2006, 2007), cardboard box furnitu...
Datum: 10.09.2007 15:18 •
Größe: 35 MB
story links: don alonso perez de guzman el bueno, remote control skates, joanne's hollywood now show on pal talk (extended paltalk interview (quicktime, windows media), x-hawk flying car (via), ochi 'dainoji' yosuke world air guitar champion (2006, 2007), cardboard box furniture patterns, related rb...
Datum: 10.09.2007 13:18 •
Größe: 35 MB
sound design
Datum: 07.09.2007 16:13 •
Größe: 10.3 MB
story links: cow milking cam from denmark, baby sumo contest in japan, teen arrested for posting youtube of himself speeding in london, hepskukkuu finland ymca remake, rb field correspondent stefan sydel sms ;) checks out splayTV from the reeperbahn, chris jordan's running the numbers, hole on mars ...
Datum: 06.09.2007 13:30 •
Größe: 21.7 MB
story links: rocketboom field correspondent ruud elmendorp covers a cell phone reporter for voices of africa
Datum: 06.09.2007 03:41 •
Größe: 29.3 MB
story links: know your meme, miss teen usa top video, top youtube videos, george bush in iraq, tony snow on issuing fake news reports, times online lays out 3-day strike plans on iran, daily kos on possible was with iran, john bolton on war with iran, fox news on war with iran, apple on nbc, nbc on ...
Datum: 05.09.2007 18:43 •
Größe: 21 MB
story links: godzilla moves to portland and terrorizes cats, inmates in philippines jail get together and dance, asian home dancer, bolywood thriller, unbreakable umbrella, tech news with shelly palmer, around america in 2.0 project, where's the beef commercial (via), justin.tv live casting, how-to ...
Datum: 03.09.2007 21:48 •
Größe: 39.6 MB
story links: baltimore attacked by algerian pirates led by jan janszoon, rocket tyler, 66 bottles of beer on the roof, eternal sunset, mr. lee cat cam, best ways to sleep at work, counting sheep, world record for sleep deprivation, ztohoven prank a czech tv broadcast, amazing balloon creations, flig...
Datum: 03.09.2007 21:46 •
Größe: 30.9 MB
story links: meteorites, nasa on meteorites
Datum: 03.09.2007 21:27 •
Größe: 29.9 MB
story links: rocketboom visits sderot israel on the border of the gaza strip, qassam/kassam rockets
Datum: 31.08.2007 22:31 •
Größe: 56.3 MB
story links: chaos theory (via), gaston julia, julia set, benoit mandelbrot, madelbrot set, fractals, earthquake predictions chaos, darpa security chaos, artificial intelligence chaos, pathology chaos, cardiology chaos, invader set
Datum: 31.08.2007 15:40 •
Größe: 36.4 MB
story: backwards through time, music: eclipse solaire by vinc2-exoplanete
Datum: 30.08.2007 17:11 •
Größe: 38.1 MB
story links: brady bunch, andy plesser on election video, john edwards (video), hillary clinton (video), barack obama (video), sam brownback, jeff jarvis on election video, bill richardson (video), richardson cowboy acting video
Datum: 30.08.2007 14:22 •
Größe: 47.4 MB
story links: second life capitol hill ushers in 110th congress with congressman george miller | space created and sponsored by clearink and sun microsystems | more capture of event: video by aldon hynes, video by nathan freitas, orchestrated by justin hamilton
Datum: 29.08.2007 19:46 •
Größe: 21.4 MB
story links: vote on where
Datum: 29.08.2007 17:06 •
Größe: 28.7 MB
story links: taipei 101, sears tower 1, 2, comparison, kvly-tv mast, cn tower 1 2, petronius oil platform, center of india, maharishi mahesh yogi, burj dubai
Datum: 29.08.2007 13:24 •
Größe: 19.2 MB
Musical Type
Datum: 28.08.2007 17:14 •
Größe: 17.6 MB
Adaptation from the Shining.
Datum: 28.08.2007 16:14 •
Größe: 9.3 MB
story links: opentopia, d & d billards, earth moon sculpture, safari vet, brandon fuller, small dog electronics
Datum: 28.08.2007 13:34 •
Größe: 23.7 MB
story links: rb field correspondent ruud elmendorp covers a rare press conference held by joseph kony, leader of the lord's resistance army (l.r.a.)
Datum: 27.08.2007 21:59 •
Größe: 57.2 MB
story links: learn to tie your shoes in just seconds [director's cut: mov | wmv]
Datum: 27.08.2007 18:02 •
Größe: 61.9 MB
story: tiki music and bar casual friday with tiki bar tv
Datum: 27.08.2007 11:59 •
Größe: 40.4 MB
story links: adam quirk and wreck & salvage adapt d.b. johnson's henry hikes to fitchburg
Datum: 24.08.2007 14:00 •
Größe: 0.1 KB
story links: interview with kent rogowski on his book bears (music)
Datum: 23.08.2007 14:38 •
Größe: 0.1 KB
story links: arsebook, disney edits boingboing out of wikipedia, corporation wikipedia edit roundup, cnn home page (screenshot), msnbc home page (screenshot), space shuttle endeavor lands safely, learning to love reenactment of e.t., sri brahmananda sarasvati, new flash version for online video, the...
Datum: 22.08.2007 15:03 •
Größe: 0.1 KB
story links: mona lisa, guillaume apollinaire, pablo picasso (the song), vincenzo peruggia, extreme ironing, escape key, watercone, elvis domain name, galactic suites, omfg
Datum: 20.08.2007 22:49 •
Größe: 0.1 KB
story links: joanne interviews susan crawford of one web day 2007
Datum: 20.08.2007 14:43 •
Größe: 0.1 KB
story links: one night of fire 2007 on the brooklyn bridge in nyc
Datum: 17.08.2007 14:00 •
Größe: 0.1 KB
story links: elvis presley missing for 30 years, elvis sightings, weekly world news on elvis image, elvislives.net website, manager colonel tom parker on elvis (image), elvis impersonator database, elvis gold medallion for bid on ebay, complete album set of 95 33 inch LPs on ebay, louis vuitton poch...
Datum: 16.08.2007 12:06 •
Größe: 0.1 KB
story links: rb field correspondent Bre Pettis shows us how to make a ring from a coin.
Datum: 15.08.2007 14:54 •
Größe: 0.1 KB
story links: dick cheney explains why the u.s. should not attack iraq (via), george bush approval ratings reach historical low, karl rove resigns, why did karl rove resign? (more), ron paul, ron paul leads republicans online, vote swapping ruled legal
Datum: 14.08.2007 14:51 •
Größe: 0.1 KB
story links: the polish port of gdynia opens, collection of unusual animals, iphone clone for sale in china (also see the meizu), space shuttle with missing foam docks with the international space station (see mission live on nasa tv), facebook misconfiguration reveals source code, hacking tools now...
Datum: 13.08.2007 12:46 •
Größe: 0.1 KB
story links: adam quirk and wreck & salvage adapt ambrose bierce's an occurence at owl creek bridge
Datum: 10.08.2007 15:34 •
Größe: 0.1 KB
story link: interview with jibjab's co-founder gregg spiridellis on the new jib-jab starring you
Datum: 09.08.2007 13:11 •
Größe: 0.1 KB
story links: rb field correspondent chuck olsen covers the yearlykos convention in chicago, il. extra: additional video coverage at theuptake.org.
Datum: 08.08.2007 14:00 •
Größe: 0.1 KB
story links: fastest milktruck, chicago o'hare
Datum: 07.08.2007 06:31 •
Größe: 0.1 KB
story links: 8 million year old cypress trees found, prometheus the oldest tree ever known, the man with green blood, big sumo wrestler, sumo blog, phoenix takes off for mars, hole on mars, walking may be worse for the environment than driving a car, nyc filming remains somewhat free, house of repre...
Datum: 06.08.2007 14:13 •
Größe: 0.1 KB
story links: adam quirk and wreck & salvage adapt franz kafka's metamorphosis
Datum: 03.08.2007 16:32 •
Größe: 0.1 KB
story links: rb field correspondent stefan seydel/sms ;-) covers shoeboxed, sounds ball, leap frogging tech, public art sports, government sports, trick sports, rocketboom helmet collection, extra: rb field correspondent chuck olsen covers the minneapolis bridge collapse, gallery of collapsed bridge...
Datum: 02.08.2007 06:41 •
Größe: 0.1 KB
story link: earth pledge foundation
Datum: 01.08.2007 17:19 •
Größe: 0.1 KB
story links: pope break dance file, pope benidictus supports evolution (image), oldest fake toe, where does everything come from, world of warcraft cover dance, aquafina tap water from pepsi, britta water filtration, sound pump, rhythm fish
Datum: 31.07.2007 13:45 •
Größe: 0.1 KB
story links: apollo 15, hello kitty dog, the beauty smile trainer, first person stand-up pinball ball, no no's, bbc iplayer requires microsoft os, uk police head cams, motorcycle dog viking helmets, modern helmet styles, foil helmet, hands helmet
Datum: 30.07.2007 13:55 •
Größe: 0.1 KB
story links: fruit tree planting foundation, sierra club's forest protection & restoration campaign, forest stewardship council, world wildlife fund on forests, raintree on rain forests
Datum: 27.07.2007 13:36 •
Größe: 0.1 KB
story links: godzilla moves to portland and terrorizes cats, inmates in philippines jail get together and dance, asian home dancer, bolywood thriller, unbreakable umbrella, tech news with shelly palmer, around america in 2.0 project, where's the beef commercial (via), justin.tv live casting, how-to ...
Datum: 26.07.2007 13:00 •
Größe: 0.1 KB
story links: rb field correspondent ryan estrada reports on monsoon season in mumbai, india
Datum: 25.07.2007 13:45 •
Größe: 0.1 KB
story links: joanne and andrew visit the kwik-e-mart on 42nd street in new york city
Datum: 24.07.2007 14:00 •
Größe: 0.1 KB
story links: you3b, brady bunch 2.0, tractor fight, mortal kombat acapella, welcome back potter, apocalypseoz, crossed lines in india (from steve lambert), will the iphone blend?, long lines for i'm not a plastic bag (1, 2, 3), i'm not a plastic bag on ebay, backwards piano
Datum: 23.07.2007 12:51 •
Größe: 0.1 KB
story link: a casual stroll through battery park
Datum: 20.07.2007 13:57 •
Größe: 0.1 KB
story links: meteorites, nasa on meteorites, links and image attribution
Datum: 19.07.2007 14:09 •
Größe: 0.1 KB
story links: rb field correspondent ruud elmendorp reports on the deadly flu strain h5n1 and measures taken for prevention in kenya
Datum: 18.07.2007 13:51 •
Größe: 0.1 KB
story links: one in three americans want an iphone, banana guard, sigmund freud head pop, lewis gordon pugh swims in the north pole, youtube doubling and track stacking with piano, didgeridoo, violin, harp, timpani, dog, number nomenclature, eight is enough, 9-volt l.e.d. lamp, making masks as hobby...
Datum: 17.07.2007 13:57 •
Größe: 0.1 KB
story links: apollo 11 takes off in 1969 for the first human flight to land on moon, one night of fire in new york city, hello kitty hell, rachmaninoff's prelude by thomas grillo on moog, internet radio still breathing, more thomas grillo on moog, youtube doubler plays two youtube video at once, ang...
Datum: 16.07.2007 14:29 •
Größe: 0.1 KB
story link: rocketboom visits jerusalem (music)
Datum: 13.07.2007 23:46 •
Größe: 0.1 KB
story: what do you think? (music)
Datum: 12.07.2007 23:57 •
Größe: 0.1 KB
story links: rocketboom visits the borders of israel (day three)
Datum: 11.07.2007 13:45 •
Größe: 0.1 KB
story: rocketboom surveys sections of israel from above
Datum: 10.07.2007 13:50 •
Größe: 0.1 KB
story links: rocketboom visits sderot israel on the border of the gaza strip
Datum: 09.07.2007 07:32 •
Größe: 0.1 KB
story: waiting for the train at grand central terminal
Datum: 06.07.2007 14:00 •
Größe: 0.1 KB
story links: happy birthday america, photo credits: jeff keen, jeffwilcox, waldo jaquith3, chispita_666, poldavo alex, theogeo, annenh, michael mx5tx, jami dwyer, dsearls, geoff mcKim, upton, southernview, quaziefoto, jp puerta, drierp
Datum: 06.07.2007 02:23 •
Größe: 0.1 KB
story links: rocketboom field correspondent andy carvin visits spin alley during the 2008 democratic us presidential debate at howard university
Datum: 04.07.2007 15:03 •
Größe: 0.1 KB
story links: rocketboom african field correspondent ruud elmendorp reports on saving the elephants in kenya's tsavo east national park
Datum: 03.07.2007 15:42 •
Größe: 0.1 KB
story links: blogference (thanks, yaron!), rb field correspondent and make podcaster bre pettis covers power tools drag racing at the seattle power tool race and derby 2007
Datum: 02.07.2007 13:28 •
Größe: 0.1 KB
story: it was a casual friday at the rocketboom studio...
Datum: 29.06.2007 17:10 •
Größe: 0.1 KB
story: apple store iphone line
Datum: 28.06.2007 11:49 •
Größe: 0.1 KB
story link: wiimbledon
Datum: 27.06.2007 08:35 •
Größe: 0.1 KB
story: save net radio
Datum: 26.06.2007 14:15 •
Größe: 0.1 KB
story links: tesla coil party, tesla coil and cage, displacement (via boingboing), zbigniew rybczynski, everest summit video page, everest summit video vote page, machine tells brain speed, rotating building (thanks tim!), time graph, space shuttle lands at home after two week stint, missing lake, d...
Datum: 25.06.2007 14:58 •
Größe: 0.1 KB
story: summer day on the water
Datum: 22.06.2007 20:30 •
Größe: 0.1 KB
story links: supercalifragilisticexpealiphone.com relisted on ebay, iphone domain names on ebay, price is rIght toast sells for $999, cyclops chicken, haunted ouji board, tornado for sale, good luck pen, time travel ring, a cookie from grandma, graveyard dirt, dinner with american idol clay aiken's ...
Datum: 21.06.2007 15:58 •
Größe: 0.1 KB
story links: baltimore attacked by algerian pirates led by jan janszoon, rocket tyler, 66 bottles of beer on the roof, eternal sunset, mr. lee cat cam, best ways to sleep at work, counting sheep, world record for sleep deprivation, ztohoven prank a czech tv broadcast, amazing balloon creations, flig...
Datum: 20.06.2007 14:06 •
Größe: 0.1 KB
story links: joanne interviews attendees winners at the 2007 webby awards
Datum: 20.06.2007 04:01 •
Größe: 0.1 KB
story links: sushi restaurant people watching, jellyfish lake, cheney's office pressing for strike on iran, john cramer studies time travel (via),
Datum: 18.06.2007 14:04 •
Größe: 0.1 KB
story links: if time was infinite and space was finite everything would repeat
Datum: 16.06.2007 02:13 •
Größe: 0.1 KB
story links: oklahoma city national memorial & museum
Datum: 15.06.2007 01:46 •
Größe: 0.1 KB
story links: rocketboom african field correspondent ruud elmendorp reports on the camel bookmobile in garissa, kenya
Datum: 13.06.2007 16:59 •
Größe: 0.1 KB
story links: chaos theory (via), gaston julia, julia set, benoit mandelbrot, madelbrot set, fractals, earthquake predictions chaos, darpa security chaos, artificial intelligence chaos, pathology chaos, cardiology chaos, invader set
Datum: 12.06.2007 13:35 •
Größe: 0.1 KB
story links: student arrested for holding equal rights for robots sign, troy was sacked and burned in 1184 b.c., neogentronyx, robotic cow tongues and stomach (via boingboing), the great missing balloon pop, governors island jazz dance, monument to smile, wireless electricity
Datum: 11.06.2007 14:06 •
Größe: 0.1 KB
story: chair box
Datum: 09.06.2007 03:25 •
Größe: 0.1 KB
story links: global warming solar shield quick fix?, pirate speak myth (via), is theseus' ship still theseus' ship?, underwater sculpture, the life of a living sculpture, street knitters, the playmobil stopmotion western, chairbot, credit card spoon and fork, wooden cars, total-time zone wrist watch...
Datum: 08.06.2007 08:00 •
Größe: 0.1 KB
will coghlan and rob millis of political lunch cover this week's 2008 us presidential debates in new hampshire
Datum: 06.06.2007 15:36 •
Größe: 0.1 KB
story links: titus besieges jerusalem, elvis debuts hound dog on the milton berle show, robert f kennedy assassinated,
Datum: 05.06.2007 21:34 •
Größe: 0.1 KB
story links: rocketboom launches new sponsorship model, new rocketboom t-shirts on sale, general lee on ebay, this spartan life, micro air vehicle, sodium accitate art, fun with tesla coils, rofl, lolcats, lolbots
Datum: 04.06.2007 15:30 •
Größe: 0.1 KB
joanne visits the steinhardt gardens in mt. kisco ny
Datum: 02.06.2007 00:29 •
Größe: 0.1 KB
Datum: 31.05.2007 14:06 •
Größe: 0.1 KB
story links: rocketboom african field correspondent ruud elmendorp covers the dandora dump site in suburban nairobi, kenya
Datum: 30.05.2007 15:10 •
Größe: 0.1 KB
story links: hole on mars, star wars mashups, water photography, no permit required for nyc documentary, general lee for auction again, hazard county swap, photoshop entries from monday
Datum: 29.05.2007 12:55 •
Größe: 0.1 KB
story links: solar eclipse in 585 b.c., san francisco zombie mob 2007 (images), the universe 3 trillion years from now, milky way mashup, rocket pun?, photoshop contest, the iraq rug, bicycle soccer, on demand crossing, the wisdom of obi-wan, wise yoda is, sony's flexible oled screen
Datum: 28.05.2007 14:00 •
Größe: 0.1 KB
story link: joanne and jimbo wales play scrabble
Datum: 26.05.2007 08:28 •
Größe: 0.1 KB
story links: rb field correspondent chuck olsen enters the mall of america
Datum: 24.05.2007 21:33 •
Größe: 0.1 KB
story links: ryan estrada investigates monkey business in mumbai, india
Datum: 23.05.2007 16:32 •
Größe: 0.1 KB
story links: maker faire, extended video set in collaboration with gizmodo
Datum: 22.05.2007 17:25 •
Größe: 0.1 KB
story links: joanne interviews andrew rasiej, craig newmark, and thomas friedman at the personal democracy forum, extended interview footage
Datum: 21.05.2007 18:18 •
Größe: 0.1 KB
story: after hours
Datum: 18.05.2007 13:56 •
Größe: 0.1 KB
story links: flickrvision, umbrella gps slideshow, full body knit, shoe recycleing, underwater golf tournament, carpet skates, 965 model rockets, typovacs, gas mask bath tile, general lee replica on ebay, mind control dj gear (via artifical eyes)
Datum: 17.05.2007 12:41 •
Größe: 0.1 KB
story links: twittervision, flickrvision, traffic cam google map mashup, university of nebraska mid-american transportation center lab, update on diy weather balloon, personal democracy forum, u.s. defense department restricts access youtube and myspace, strange newark airport singing session, digg ...
Datum: 16.05.2007 14:15 •
Größe: 0.1 KB
story links: rocketboom's kenyatta cheese visits phillip torrone and bre pettis at the etsy lab in preparation for this weekend's make faire
Datum: 15.05.2007 14:27 •
Größe: 0.1 KB
story links: bush resigns mistake broadcast on cnn is real, this day on may 14th , new oldest known star, bacteria discovered living in tar pits, jonathan keller picture-a-day art, building with still frames in time, artichoke machine, sleeping bag walking suit, via the cool hunter, rocketboom ytmnd
Datum: 14.05.2007 14:44 •
Größe: 0.1 KB
story links: cbs evening news low point, nbc nightly news records low point, alligator eggs, aol password problems, ulam spiral, supplemental shrubbery, smoke ring machine, moon is in at nasa, quilted asbestos gloves, open source cinema, violin bow and metal fencing, foot surfing rocks in yemen, mal...
Datum: 10.05.2007 13:10 •
Größe: 0.1 KB
story links: rb field correspondent ruud elmendorp covers computers for schools kenya on e-waste and computer recycling in africa
Datum: 09.05.2007 12:21 •
Größe: 0.1 KB
story links: ustream, 2001 kottke cam, 1995 xmas cam, opentopia webcams, 6800 pacific ave omaha nebraska, 6800 pacific ave cams with tracking, 6808 pacific ave cam with tracking, university of nebraska mid-american transportation center lab, matc lab cam, matc lab people, just deserts bakery
Datum: 08.05.2007 13:51 •
Größe: 0.1 KB
story links: republican presidential contenders who disbelieve evolution, george bush at low point with 28% popularity, cookie monster eats a computer (via), rocketboom translations, 09f911029d74e35bd84156c5635688c0.ws, $40 q-tip for sale on ebay, dukes of hazzard general lee car fetches over 9 mill...
Datum: 07.05.2007 12:05 •
Größe: 0.1 KB
story: music in the park
Datum: 04.05.2007 14:11 •
Größe: 0.1 KB
story links: joao i, lester bookbinder, terms of the 1970s, terms of the 1980s, terms of the 1990s, rep tim ryan opposition to bush bill, street skater dalnas, nasa titan landing data, nasa funky education, michael jackson glove data, balancing can
Datum: 03.05.2007 09:56 •
Größe: 0.1 KB
story links: circuit bending at the new york city bent festival
Datum: 02.05.2007 13:51 •
Größe: 0.1 KB
story links: jott speech to text email, mojave desert phone booth project, rocketboom on cell phone time-to-play, 4 leaf clover collection, green water chicago, what if the beatles were irish?, million dollar documentary, watermelon sculpture, wow at voorut
Datum: 01.05.2007 14:31 •
Größe: 0.1 KB
story links: george washington takes first oath as president of the united states, history of nbc,
Datum: 30.04.2007 14:29 •
Größe: 0.1 KB
story links: final times for coney island's astroland, music by kris
Datum: 27.04.2007 13:56 •
Größe: 146.5 KB
story links: rocketboom with closed captioning and multiple languages on dotsub free video wiki tool
Datum: 26.04.2007 14:04 •
Größe: 146.5 KB
story links: japanese street painters rinpa eshidan ????? blog tv!
Datum: 25.04.2007 14:12 •
Größe: 146.5 KB
story links: the global incident map, terrorism awareness project, 100 year predictions made in the year 1900, wireframe car sculpture by benedict radcliffe, fatclownmoron re: saerain re: sorrow, monkey bot, table cloth magic, kramer performance breakdown, mike daisey's performance recovery
Datum: 24.04.2007 14:04 •
Größe: 146.5 KB
story links: earth day, bee mystery, einstein bee quote mystery, the kereoke death match 100, hands-free jump rope machine, radio waves used to eavesdrop on contemporary computer monitors, only 244 copies of microsoft vista sold in china, microsoft admits vista failure, scoble on microsoft's loss of...
Datum: 23.04.2007 18:23 •
Größe: 146.5 KB
story links: happy earth day!
Datum: 21.04.2007 02:27 •
Größe: 146.5 KB
story links: rocketboom receives 3 honorable mentions for 2007 webby awards, podcast hotel, bandon-to-youtube update, rocketboom in closed caption and other languages, timothy yue taps with bill bojangles, watching cheese grow, china's yangtze river reaches point of no return (images by kthypryn), t...
Datum: 19.04.2007 13:19 •
Größe: 146.5 KB
story inks: u.s. spending report for war on terror since 9/11, city projections of teenage mutant ninja turtles, spit art, no-skiing london tube stickers, change in concentration of wealth, price for life at nasa, price for life in iraq, citizen urban armor, karl rove's lost e-mail trove, geek squad...
Datum: 18.04.2007 13:52 •
Größe: 146.5 KB
rb field correspondent bre pettis on the second balloon launch for make
Datum: 17.04.2007 12:18 •
Größe: 146.5 KB
story inks: hans johnson's massai school project in southern kenya by rb field correspondent chuck olsen
Datum: 16.04.2007 12:41 •
Größe: 146.5 KB
story links: what do you represent? music (by drew), related (thanks, nick!)
Datum: 13.04.2007 13:26 •
Größe: 146.5 KB
story links: evolution vs. peanut butter, evolution vs. banana, laraque vs ivanans, bush vs. all people, bush standing vs bush standing, don imus vs. black people, geraldo vs. oreilly, mother vs. son, rumsfield vs. evidence, newt vs. spanish people, list of logical fallacies from the art of reason, ...
Datum: 12.04.2007 14:09 •
Größe: 146.5 KB
story links: dominic allen of scarab studio covers ian skiller for ripples on the arrival of refugees to his australian farm
Datum: 11.04.2007 13:30 •
Größe: 146.5 KB
story links: plexiglass lightning, ice cream headache remix project (mp3), face transformer, 1-800-goog411 free telephone information, more "worst to come" global warming reportia, undersea restaurant, extended home aquarium, acme catapult (via cre.ations), greenland auto gps-bot (video), bagel in C...
Datum: 10.04.2007 13:20 •
Größe: 146.5 KB
story links: thailand bans youtube for videos defacing the royal family, the infinite cat project, shot spotter, senster interactive robot (video), rocketboom twitter pro, collection of strange maps, secret soviet plans for removal of north american, navigating a dome screen with the wii (video), ki...
Datum: 09.04.2007 11:51 •
Größe: 146.5 KB
story links: what do you represent? created by texas93 and tagged videoblogging week 2007
Datum: 06.04.2007 13:20 •
Größe: 146.5 KB
story links: million dollar documentary (thanks, scott!), youtube can youtube hear me?, david lynch on product placement, david lynch weather report, homeless signs for toronto (thanks, wareinga!), death-star attack conspiracy theory, new laptop for driving. rudy rucker on mathematics and physics (t...
Datum: 05.04.2007 14:25 •
Größe: 146.5 KB
story links: microsoft forms, apollo 6 launches, beatles top charts, videoblogging 2007 week, 8675309, leet speak, poetry vlog, pac man re-enactment, lipstick stencil, multi-touch interface design, star trek flat (thanks john!), broadcasting headset monitor, justin.tv, second life gets flooded by ad...
Datum: 05.04.2007 01:23 •
Größe: 146.5 KB
story links: rb field correspondent ruud elmendorp covers reactions in nairobi to the installation of gps trackers in taxi cabs
Datum: 03.04.2007 14:01 •
Größe: 146.5 KB
story links: joanne interviews nic hill on his upcoming wikidocumentary truth in numbers about jimmy wales and wikipedia
Datum: 02.04.2007 14:16 •
Größe: 146.5 KB
around chinatown
Datum: 30.03.2007 15:46 •
Größe: 146.5 KB
story links: rocketboom on twitter, bbq, discardia, hair cut, brain diseases, cisco 7940g, working, incredible horse stunt, weather, mario brothers line rider, escalator skiing, awkward moments on tape, ordering toner, peanuts, robogeek
Datum: 29.03.2007 14:10 •
Größe: 146.5 KB
story links: rb field correspondent josh kinberg on the new york police department's illegal surveillance of his 2004 bikes against bush project (nytimes article)
Datum: 28.03.2007 17:55 •
Größe: 146.5 KB
story links: charles, orang utan near extinction, part sheep part human animal (thanks b-man!), philip glass buys a loaf of bread, 10 things about einstein (via fimoculous), atari centepede, brain control patent, modern stonehenge man
Datum: 27.03.2007 13:48 •
Größe: 146.5 KB
story links: interaction bot infranoid project (video), cgi city bot by kaktus, beer run bot, tellmeywadenki, bionic hand, humanoids with muscle, festo muscle (video), mmm food bot (via metafilter), electronic hot dog, saturn rotation, saturn's moon titan, moons rotating around saturn, bw sun flare,...
Datum: 26.03.2007 13:52 •
Größe: 146.5 KB
story links: projecting forward (thanks, g.f.l!), music
Datum: 23.03.2007 14:45 •
Größe: 146.5 KB
story links: apple tv, screen distance = content length, rocketboom hd, stupidr, kevin ferdeline search, mario bros stop motion lego, mario bros three trombones (via boingboing), uniwheeling, used incinerator, antique cake crumbs
Datum: 22.03.2007 13:50 •
Größe: 146.5 KB
story links: new rb australian field reporter stephen pascoe covers the university of new south wales solar racing team as they prepare for the world solar challenge, music by eric camilleri
Datum: 21.03.2007 13:37 •
Größe: 146.5 KB
story links: diy fusion reactor, superman turkey, superman india, 248 dimensions mapped in e8, list of twitter apps (rocketboom on twitter), graffiti research laser pointer writing (video), zero-g experience with stephen hawking ebay auction, r2d2 mailboxes, united for peace protest poster, dog fetc...
Datum: 20.03.2007 14:29 •
Größe: 146.5 KB
story links: twitter, high school student creates fusion reactor, los iniciadios marca de anubis, brook benton's father time, djon trick skate designs, interactive modal table (video), god-tube, nasa mars simulation, accordion hero ii (via waxy), vintage to robot head gallery, twenty short animation...
Datum: 19.03.2007 14:25 •
Größe: 146.5 KB
story links: ides of march, rocketboom website upgrades, ransom, astor place square, deleted youtube videos, in search of a time machine, time dilation, gravitational shifts, reverse transits, dollar time
Datum: 15.03.2007 13:44 •
Größe: 146.5 KB
story links: rb field correspondent chuck olsen interviews miles beckett and greg goodfried, the creators of lonelygirl15
Datum: 14.03.2007 13:54 •
Größe: 146.5 KB
story links and votes: rb field correspondents andy carvin and chuck olsen interview dan rather at sxsw
Datum: 13.03.2007 14:52 •
Größe: 146.5 KB
story links: **monday episode 3/12 on hold for site upgrade - stand by for awesome interviews this week including the producers of lonleygirl15 & dan rather | meh, star trek apartment leads to bankruptcy, motorized desk chair, big wheel easter in san francisco, bowling people, two snouted pig, omele...
Datum: 08.03.2007 14:34 •
Größe: 146.5 KB
story links: south by southwest interactive conference with rocketboom, jetset (smashface), ask-a-ninja, revision3 and ryan is hungy (podtech), barcamp austin, official sxswi austin party with 30 boxes and satisfaction, politics online conference, von conference (mapping with smoke), podcamp nyc, sc...
Datum: 07.03.2007 14:07 •
Größe: 146.5 KB
story links: rb field correspondent bre pettis, prepares for space
Datum: 06.03.2007 17:44 •
Größe: 146.5 KB
**tuesday episode coming today at 12:30pm e.s.t | story links: ransom notes, wreck and salvage (featured episode), ebay ad auction, rocketboom ad creation (example), endangered white rhinos (images), bee c.c.d., sleep awareness week, possible new ocean under asia, 2001 space oddyssey, lunar eclipse,...
Datum: 05.03.2007 14:18 •
Größe: 146.5 KB
story: vimeo 163464
Datum: 02.03.2007 15:28 •
Größe: 146.5 KB
story links: rb field correspondent milt lee covers kili radio station in pine ridge
Datum: 01.03.2007 13:19 •
Größe: 146.5 KB
story links: dord, dna to music sequencer (audio), website to dna representation, brain therapy patent, elastic shoe patent, 867-5309's
Datum: 28.02.2007 13:59 •
Größe: 146.5 KB
story links: sea animal findings in melting ice caps, painted animals, cross breed hybrid animals, beer launching fridge animal, piano playing cat, astronauts that go animal in space, nasa procedure for astronauts that go animal
Datum: 27.02.2007 13:14 •
Größe: 146.5 KB
story links: giant sinkhole on google maps, fort worth texas sinkhole, steam powered robot (video) via boingboing, terrorists hit second life, second life liberation army, u.s. government forbids sale of domain names to terrorists, finding jesus, japan launches spy satellite, horizon's probe to send...
Datum: 26.02.2007 13:57 •
Größe: 146.5 KB
story links: nyc pillow fight [preview interview, last year's rb coverage]
Datum: 25.02.2007 03:30 •
Größe: 146.5 KB
story links: nyc pillow fight preview interview with lori and kevin of newmindspace [full pillow fight coming on saturday] (last year's rb coverage)
Datum: 23.02.2007 14:16 •
Größe: 146.5 KB
story links: interview with bunker roy of barefoot college (thanks, andrew!)
Datum: 22.02.2007 14:59 •
Größe: 146.5 KB
story links: rb field correspondent bre pettis engages in egg dropping for make
Datum: 21.02.2007 14:28 •
Größe: 146.5 KB
story links: baghdad market bombings , pakistan train bombings, lebanon bus bombings, terrorist kidnappers tried in italy, italians march in protest u.s. base, 14 billion text messages expected in china, eliminate greenhouse gasses and win $25million, australian bank issues cat credit, norway build...
Datum: 20.02.2007 14:31 •
Größe: 146.5 KB
story links: demographics study results [full report] (thanks, rob!), rocketboom interview on american microphone, humvee driving in iraq, volkswagen jumper ad, south korean computer fashion show, plain pink purse, send in your ideas for story links
Datum: 19.02.2007 14:23 •
Größe: 146.5 KB
casual friday
Datum: 17.02.2007 06:57 •
Größe: 146.5 KB
story links: american international toy fair 2007, k'nex, me2, myachi, robotkits, freehand yo-yo, levitating car, rubix revolution, emerson karaoke, scribble mats, my beating heart, all-season sled
Datum: 15.02.2007 21:25 •
Größe: 146.5 KB
story: happy valentines day | music: nocturne op post c# by frederic chopin
Datum: 14.02.2007 13:59 •
Größe: 146.5 KB
story links: mate choice copying, heart attack faking, your own romance novel, couple found in historic embrace, studded earphones, mute, will blend valentine gifts, brokeback star trek
Datum: 13.02.2007 14:06 •
Größe: 146.5 KB
story links: dr.seuss literature class (thanks, roger!), interactive bar table display, inkless printer, banning ipod oblivion, longest domain name, scientologist keith henson in jail (thanks, david!), wi-fi on the mesh, guidance system shoes, ipod lock, beware of milk from udder, giant sea boats, w...
Datum: 12.02.2007 12:37 •
Größe: 146.5 KB
story: backwards through time | music: eclipse solaire by vinc2-exoplanete
Datum: 09.02.2007 13:59 •
Größe: 146.5 KB
story links: kite dance (thanks, jeff!), largest machinima dance, worlds fastest drummer (thanks, tamarah), fast typer, google maps aid war in iraq (thanks, stephane!), google maps aid discovery of rainbow unicorn, daily monster (thanks, leighsah!), giant slug, pcb puppet (thanks, gijs!)
Datum: 08.02.2007 14:42 •
Größe: 146.5 KB
story links: rb field correspondent steve garfield covers the new england belt sanders association's winter nationals | extra: audience demographic survey
Datum: 07.02.2007 15:13 •
Größe: 146.5 KB
story links: plans to outlaw incandescent lightbulbs, global warming irrefutably linked to human activity, global warming to hit the poor the worst, climate dread, high amount of pack ice drifting in icelandic waters (image), low-toxic folding chair, skin bags, catfish grabbin, unsolved problems, st...
Datum: 06.02.2007 14:23 •
Größe: 146.5 KB
story links: rocketboom is not on federated media network, sponsor or advertise on rocketboom, *rocketboom audience survey, graffiti research lab (recent rocketboom video), mooninites (news video), prize for fake websites, art student places boxes of fear in nyc subway circa 2002, megatronics will t...
Datum: 06.02.2007 03:13 •
Größe: 146.5 KB
story links: a new york fairy tale, music by au lit les momes
Datum: 02.02.2007 08:23 •
Größe: 146.5 KB
story links: edward iii crowned king of england, teenager counter sues recording industry, underbed tv lift, scooter libby trial coverage (thanks, kevin l!), speedometer videos, give design suggestions for nyc dwellers, ding hai effect, weird local tv commercials, le grand content
Datum: 01.02.2007 13:17 •
Größe: 146.5 KB
story link: rb field correspondent ruud elmendorp covers clashes at the nairobi mathare slum
Datum: 31.01.2007 14:05 •
Größe: 146.5 KB
story links: patient fixes hospital machine, every n.e.s. game ever on ebay, ray harryhausen (creature list, little miss muffet), current tv (screen shot), phillip torrone, shocking alarm clock, bacon cooking alarm clock, retro gaming light gun alarmclock hack, clocky alarm clock website
Datum: 30.01.2007 18:39 •
Größe: 146.5 KB
story links: intel announces major processor upgrade using halfium instead of silicon, amd and ibm announces major processor upgrade using halfium instead of silicon, gemotion 3d projection screen (thanks, christian d.!), digital monoculture in south korea, line rider urban run, rb field corresponde...
Datum: 29.01.2007 12:37 •
Größe: 146.5 KB
story: casual friday in the subway with the telephone camera
Datum: 26.01.2007 13:54 •
Größe: 146.5 KB
story links: graffiti research lab, eyebeam and the anti-advertising agency on nyc's graffiti problem inspired by jo lee's abstractor tv, original video by steve lambert, music by ratatat (thanks kenyatta!)
Datum: 25.01.2007 13:36 •
Größe: 146.5 KB
story links: on the grand central terminal ceiling (on flickr, on youtube), nokia n93
Datum: 24.01.2007 14:31 •
Größe: 146.5 KB
story links: brady bunch, andy plesser on election video, john edwards (video), hillary clinton (video), barack obama (video), sam brownback, jeff jarvis on election video, bill richardson (video), richardson cowboy acting video
Datum: 23.01.2007 14:19 •
Größe: 146.5 KB
story links: international bag day, trondheim's trampe bicycle lift (thanks, ariel!), horizontal bungie jumping, art gallery ping pong, international space station status report on experimentation and docking, refrigerator webcam in japan (response), frank lloyd wright home rendered in half life (fu...
Datum: 22.01.2007 14:38 •
Größe: 146.5 KB
story: paper or plastic
Datum: 19.01.2007 14:32 •
Größe: 146.5 KB
story links: doug aitken's sleepwalkers at the moma | music: april by jacob cooper
Datum: 18.01.2007 14:31 •
Größe: 146.5 KB
story links: world population clock, china population, china imports western culture [1, 2, 3, 4], western culture does not import much chinese culture, david weinberger on china's effect on the internet, drew on internet's effect on china, world-wide internet users statistics, china tops 20 million...
Datum: 17.01.2007 14:40 •
Größe: 146.5 KB
story links: rb field correspondents bre pettis (for make) and steve garfield build a webcam bird feeder (extended tutorial)
Datum: 16.01.2007 14:18 •
Größe: 146.5 KB
story links: rb video mashup (thanks, raymond kristiansen!), martin luther king day (video), comet mcnaught, spitzer telescope spots first glow, world champion freehand drawer, mythical cycloptic flying sea monster, engadget reports 10-million page views during the day apple release day, apple iphon...
Datum: 15.01.2007 14:33 •
Größe: 146.5 KB
story: fun with archives
Datum: 12.01.2007 13:38 •
Größe: 146.5 KB
story links: c.e.s. vs. macworld thanks to enric(video) and jadonnelly(video) and ronen(intro mashup), music by drew
Datum: 11.01.2007 19:54 •
Größe: 146.5 KB
story links: nyc smelled, bird deaths shut down downtown austin, dick cheney goes hunting again, 100 billion for new nuclear warheads, florescent green pigs, video on germs, german inventions, medication for dog obesity, in-shell vaccine for chick disease, helga (thanks, robbie!) | music: neos bop b...
Datum: 09.01.2007 14:02 •
Größe: 146.5 KB
story links: boom mashup (thanks, ronen!), daily lit, peekvid tv and movies online, mindstorms lego car factory, six degrees of wikipedia, first look at possible iphone, macworld expo, bill gates keynote at c.e.s. (thanks, edelman!), the ordinary adventures of tomas, joanne to interview michael apte...
Datum: 08.01.2007 15:11 •
Größe: 146.5 KB
story links: second life capitol hill ushers in 110th congress with congressman george miller | space created and sponsored by clearink and sun microsystems | more capture of event: video by aldon hynes, video by nathan freitas
Datum: 05.01.2007 14:01 •
Größe: 146.5 KB
story links: itv, macworld expo, social politics, hybrid assistive limb 5, this spartan life, jimbo van gogh, capitol hill in second life, rocketboom in closed caption and translations (example), send in your stories
Datum: 04.01.2007 13:08 •
Größe: 146.5 KB
story: new year's resolutions
Datum: 29.12.2006 14:31 •
Größe: 146.5 KB
story link: joanne interviews john edwards in new orleans on run for presidency
Datum: 28.12.2006 12:44 •
Größe: 146.5 KB
story links: rocketboom video of john edwards announcing intentions to run for president for youtube.
Datum: 28.12.2006 12:40 •
Größe: 146.5 KB
story links: holiday interview with creative director of barnys department stores simon doonan on his andy warhol inspired window display
Datum: 26.12.2006 13:21 •
Größe: 146.5 KB
story links: merry christmas ipod fire place (small, wide, large, youtube)
Datum: 25.12.2006 07:04 •
Größe: 146.5 KB
story links happy holidays from rocketboom zadi diaz, chuck olsen, milt lee, graham walker, steve garfield, bre pettis, stefan m. seydel/sms ;-), andy carvin | music: away in a manger by m. ajero, deck the halls/we wish you a merry xmas by doug Boldt
Datum: 22.12.2006 10:36 •
Größe: 146.5 KB
story links: boingboing year-end video post recap (rss feed), plane repair with duct tape, mobile car shreder, moscow in 1908, tracking santa, truth and method by hans-greorg gadamer, al-qaeda hints at talks with u.s., limited inc. by jacques derrida, steve jobs goes boom, crowded japanese subway, d...
Datum: 21.12.2006 13:57 •
Größe: 146.5 KB
story links: u.s. year end bank statement (treasury report), bush requests more troops for losing war in iraq, dow jones at record high, suborbital jets for future express flights, brain-controlled robots (electroencephalography), remote spy rc car, air drumming (thanks, pete!) | translate this epis...
Datum: 20.12.2006 11:33 •
Größe: 146.5 KB
story links: nyu interactive telecommunications biannual graduate showcase, professor marianne petit, botanicalls, people in jars, personal range finder, the human race, muttering hat, futureTV (labeld infortv), vlogbot (labeled futuretv), network performance shoes, music by broken nes, all projects
Datum: 19.12.2006 13:45 •
Größe: 146.5 KB
story links: kishkish lie detector (via), robosapien v2, flamosapien, samsungs machine gun, books without network errors ad, satan book of hell on ebay, atomic energy lab, call from katrin at ehrensenf concerning danny and nina move to denver (not plano), dotsub rocketboom translated into to french,...
Datum: 18.12.2006 13:29 •
Größe: 146.5 KB
story links: candy cane reef notes, vote plano! | final day of audience submitted links (happy holidays!)
http://www.thekn0wledge.com
News site about everything and nothing
http://www.malecare.com
nonprofit men's health care site, with emphasis on men diagnosed with cancer
Great music from the...
Datum: 15.12.2006 14:16 •
Größe: 146.5 KB
story links: vote on where ehrensenf, translations | audience submitted links (add yours & your favorites for friday)
http://man-descending.blogspot.com/
http://lumo.net.ms/
German Lumo WEB TV
http://thenameiwantedwastaken.com
http://home.myspace.com/index.cfm?fuseaction=user&MyToken=c2f8...
Datum: 14.12.2006 14:30 •
Größe: 146.5 KB
wii have a problem (thanks, adam!), wii controller to lightsaber, joanne trains with the force, usb missile launcher, send us your links and we'll link to you, the solar death ray (thanks, tim!), vote on t-shirt finalists, story on our vloggie, gadanskst, timmy tap, piglatin searlfearch
Datum: 13.12.2006 13:44 •
Größe: 146.5 KB
story links: rb field correspondent steve garfield interviews the boston typewriter orchestra
Datum: 12.12.2006 13:46 •
Größe: 146.5 KB
story links: nasa launch, water on mars (video), iepex pipe organ, parallel parking device (ppd), rocketboom second life player, archie mcphee catalog | music: (1,2,3)
Datum: 11.12.2006 14:12 •
Größe: 146.5 KB
story links: mechanical sculptor steve gerberich, miles davis video game music by tyler riggs
Datum: 08.12.2006 14:44 •
Größe: 146.5 KB
story inks: rb field correspondent bre pettis puts together a shovercraft for make
Datum: 07.12.2006 14:14 •
Größe: 146.5 KB
story links: france 24, carl jan königel, netherlands, emeka okafor, usa (s. africa), gilles klein, france, giuseppe granieri, italy, juan valera, spain, loïc le meur, france, luca conti, italy, roba assi, jordan, robert basic, germany, tristan nitot (firefox market share), telemann duet in b flat b...
Datum: 06.12.2006 13:27 •
Größe: 146.5 KB
story links: paternoster (thanks, james!), mission stairs, skigliding on the eiger by acro-base (video), jean-yves blondeau buggy rollin (video), make a little move on the dance floor by goovisions
Datum: 05.12.2006 14:17 •
Größe: 146.5 KB
story links: taipei 101, sears tower 1, 2, comparison, kvly-tv mast, cn tower 1
2, petronius oil platform, center of india, maharishi mahesh yogi, burj dubai
Datum: 04.12.2006 06:53 •
Größe: 146.5 KB
story links: trade up continued (thanks chiossone and spa treats), part 1, part 2, music: paganini variations by harian glotzer
Datum: 01.12.2006 14:41 •
Größe: 146.5 KB
story links: phillip torrone on make's open source gift guide, open source x0xb0x synthesizer with sequencer, rotary cell phone, open source chumley squeezable wi-fi bean-bag computer, minty boost usb charger kit, electronic game kit, daisy mp3 player kit, xgamestation pico edition 2.0, make control...
Datum: 30.11.2006 14:09 •
Größe: 146.5 KB
story links: joanne interviews peter rojas of engadget at a samsung mobile monday | music: bach prelude suite #1 by cello journey
Datum: 29.11.2006 13:45 •
Größe: 146.5 KB
rb field correspondent chuck olsen of mnstories covers interactive toy sculpture artist anastasia ward
Datum: 28.11.2006 13:00 •
Größe: 146.5 KB
story links: zune is a failure, odds of dying, super heros growing old (via), rb field correspondent steve garfield interviews jay rosen on new assignment.net (extended interview), marcy's imperial march and the bluies(quicktime) vs. the peachies(quicktime), water injected turbine, vote on tshirt de...
Datum: 27.11.2006 13:33 •
Größe: 146.5 KB
story links: macy's thanksgiving day parade, imperial march
Datum: 24.11.2006 15:08 •
Größe: 146.5 KB
story links: happy thanksgiving new york city rescue mission, under the overpass
Datum: 23.11.2006 14:55 •
Größe: 146.5 KB
story links: interview with david blaine suspended inside a gyroscope
Datum: 22.11.2006 11:29 •
Größe: 146.5 KB
story links: rb field correspondent ruud elmendorp covers somali refugees currently stranded by floods
Datum: 21.11.2006 05:21 •
Größe: 146.5 KB
story links: ps3 lines (thanks, ktb, azote!), ps3 ebay auctions (thanks, dave!),
Datum: 20.11.2006 05:39 •
Größe: 146.5 KB
musical type
Datum: 17.11.2006 11:53 •
Größe: 146.5 KB
story links: joanne visits huong ngo's pop-up studio, music by evan tate (thanks, kenyatta!)
Datum: 16.11.2006 10:36 •
Größe: 146.5 KB
story links: rb los angeles field correspondent zadi diaz interviews daniel james on painted shoes
Datum: 15.11.2006 08:18 •
Größe: 146.5 KB
story links: czechoslovakia became a republic, the communist party of spain day, 90377 sedna discovered, louis nicolas vauquelin passes away, the perfect face for comedy?, ricky gervais, maurice of nassau prince of orange and yanni, collective standards of photo beauty, msie windows simulation, diet...
Datum: 14.11.2006 08:50 •
Größe: 146.5 KB
story links: sixtymins ytmnd, lasse gjertsen on drums and piano, jetset, brandon's pitch, the mobile mini circus for children in afghanistan (thanks, berit & david!), rocketboom hi-def on movedigital, rocketboom hi-def on dovetail, last call for rocketboom t-shirts, ebay auction for vloggie, 2 gymna...
Datum: 13.11.2006 13:19 •
Größe: 146.5 KB
story links: line rider, line riders anonymous, music: tank! by yoko kanno and the seatbelts
Datum: 10.11.2006 14:07 •
Größe: 146.5 KB
democrats gain control of house, democrats gain control of senate, democrats gain control of donald rumsfeld, 3d wiki kitchen, eric conveys an emotion wearable home theather, santorum concession (1, 2), music: goose creek bands
Datum: 09.11.2006 15:02 •
Größe: 146.5 KB
story links: steven sacks of bitforms gallery features michael najjar (music: paganini variations by harley glotzer)
Datum: 08.11.2006 14:10 •
Größe: 146.5 KB
story links: command n, geek brief, steve garfield, tikibar, i make things, channel federator, captain humphreys, viviendo con fallas, wine library t.v., 88slide, ehrensenf, (music by devin anderson), rb awards ebay auction page, podtech (photos 1,2,3), internet bench in gdansk, set of deceptive ima...
Datum: 07.11.2006 14:28 •
Größe: 146.5 KB
story links: saddam, the vloggies full list of winners, vloggie video, vloggie images (thanks, jonny!) alive in baghdad (rb interview), jetset show, minnesota stories, get your own vloggie ebay auction, design a rocketboom tshirt, happy birthday to matthew w.
Datum: 06.11.2006 14:11 •
Größe: 146.5 KB
story links: dale chihuly exhibition at the ny botanical gardens
Datum: 03.11.2006 09:49 •
Größe: 146.5 KB
story links: reddit acquired (thanks leron!), pac man pie graph, rb field correspondent ruud elmendorp wins international vj award for work on joseph kony, how to tell you have browser worms (thanks, john r.!), webcam input (thanks, joel, g.!), submit your t-shirt designs, rb field correspondent bre...
Datum: 02.11.2006 12:56 •
Größe: 146.5 KB
story: nyc halloween parade
Datum: 01.11.2006 13:22 •
Größe: 146.5 KB
halloween
Datum: 31.10.2006 11:13 •
Größe: 146.5 KB
story links: reddit, how to create a bottomless pit, not really so scary tshirts, the worst halloween costumes of all time, really the worst halloween costumes of all time, dog costumes, ipod costume, single attack kills 300 us troops and cia and 100+ iraqis, pumpkin computer, virtual hologram effec...
Datum: 30.10.2006 13:44 •
Größe: 146.5 KB
story links: interview with a pumpkin, conceived by joanne, animated by ian savage, written, animated, and sculpted by joe vena, filmed at the children?s museum of the arts | out takes [mov|wmv], extras [mov|wmv]: hannah bos, oliver butler, and paul thureen of the debate society, process | add to t...
Datum: 27.10.2006 12:18 •
Größe: 146.5 KB
story links: colorful horse jockey uniforms, ultra transformer, diver man, jetpack man, inflicting pool by dj flack, no vegemite ban [also] (thanks jennie and adrian!), cylon pumpkin (video), eye smoke man, wearable kinetic sculptures, extreme drive through ordering
Datum: 26.10.2006 13:12 •
Größe: 146.5 KB
story link: rb field correspondent ruud elmendorp reports on the recent mobile phone revolution in kenya
Datum: 25.10.2006 12:46 •
Größe: 146.5 KB
story links: space elevator games, iran is limiting download speeds to 128kbs, america bans the importation of vegemite from australia, oj simpson book rumor said to not be true, suicide robot (video, search), cbgbs, ratio of content to ads on news sites
Datum: 24.10.2006 12:50 •
Größe: 146.5 KB
story links: flash games at atella artois, black raspberry beer, create your own beer, make your own beer label, pirates, smuttynose, and capt. blackbeard!, the beer institute, beer reviews
Datum: 23.10.2006 06:02 •
Größe: 146.5 KB
story: making mood music with richard mannoia and rachel shapiro of the mish mash music company
Datum: 20.10.2006 13:07 •
Größe: 146.5 KB
story links: rocketboom episode #501, scene by ronen, scene by b-man, scene by aaaaAAACHOOoooo, scene by steve garfield, scene by aaaaAAACHOOoooo, scene by aaaaAAACHOOoooo, scene by fred, scene by aaaaAAACHOOoooo, scene by leron
Datum: 19.10.2006 13:37 •
Größe: 146.5 KB
story links: fragrance week, firmenich sugar lounge, le labo, music: cafe concert by georges gasquy
Datum: 18.10.2006 11:43 •
Größe: 146.5 KB
story links: waterball, widescreen ipod, flash earth mapping, body bean bag, scarry drill (thanks, ted!), sonic body pong (via)
Datum: 17.10.2006 10:17 •
Größe: 146.5 KB
story links: sanctions against north korea underway, urban camouflage, voting machine hacks (more), cbgb's closes (thanks, gordon b.), paper trade, 60 vacuum cleaners, international space station cross-lunar transit photos
Datum: 16.10.2006 13:12 •
Größe: 146.5 KB
story links:interview with kess quinn (aka versu richelieu) and reuben steiger with millions of us on a live 72 hours installation build-a-thon called live withouit bounderies for intel, music: reception is suspected | sponsorship: call2recycle rechargeable battery recycling corporation
Datum: 13.10.2006 13:17 •
Größe: 146.5 KB
story links: rb field correspondent ruud elmendorp covers local opinion regarding the ongoing l.r.a. talks [related], joanne interviews john edwards on recent trip to uganda [related] | sponsorship: call2recycle rechargeable battery recycling corporation
Datum: 12.10.2006 13:04 •
Größe: 146.5 KB
story links: claymation class led by ian savage at the childrens museum of the arts completes project | sponsorship: call2recycle rechargeable battery recycling corporation
Datum: 11.10.2006 13:23 •
Größe: 146.5 KB
story links: hubless bicycles, pacelman (thanks, nab!), all simpsons episodes, all family guy episodes, rb necklace ebay auction won by philip morgan, interview with united nations millennium campaign [wmv|mov], apollo pony, motion abbey, send in story ideas to stories @ rocketboom, north korea has ...
Datum: 10.10.2006 13:27 •
Größe: 146.5 KB
story links: rb field correspondent chuck olsen covers leif ericson day in st. paul minnesota, new japanese inventions, inflatable restraint personal airbag for airplanes, wet shaving tutorials (via metafilter), lets knit together knitting show, firefox 2.0, firefox pacman extension (thanks, nab!), ...
Datum: 09.10.2006 13:08 •
Größe: 146.5 KB
story: waltz in the park
Datum: 06.10.2006 13:27 •
Größe: 146.5 KB
story link: elizabeth edwards book tour | extra: john edwards on the lord's resistance army [mov|wmv]
Datum: 05.10.2006 17:21 •
Größe: 146.5 KB
rb field correspondent steve garfied interviews peter houk the lab director of the m.i.t. glass lab on the great glass pumpkin patch [images by andrea silverman and steve garfield]
Datum: 04.10.2006 21:38 •
Größe: 146.5 KB
story links: podcast and portable media expo, cali lewis, jim kirks, zadi diaz, liberated syndication, podcast pickle, tim bourquin, rudy jahchan, tiffany young, dina kaplan, chris brogan, jason van orden, bre pettis, jake ludington, kent nichols, leesa barnes, robert walch, daniel mcvicar, paul col...
Datum: 03.10.2006 13:33 •
Größe: 146.5 KB
story links: nextfest, hug shirt, kickass kung-fu, virtual canoe, virtusphere, pay by touch, digiwall, ballroom dancing, pay by touch, virginia tech ethanol hybrid car
Datum: 02.10.2006 13:13 •
Größe: 146.5 KB
story links: nextfest, paro seal robot, hubo lab einstein-y robot, playmotion, shadow robot robo-arm
Datum: 29.09.2006 09:05 •
Größe: 146.5 KB
story links: a refugee camp in the heart of the city, doctors without borders
Datum: 28.09.2006 08:55 •
Größe: 146.5 KB
story links: rb field correspondent and world rps society manager graham walker on rock, paper scissors
Datum: 27.09.2006 09:09 •
Größe: 146.5 KB
story links: rocketboom ebay auction, robot travels through intestines (via new scientist tech), walking japanese robot, foobar (thanks, john c.), rb field correspondent andy carvin covers virgin music festival, wolf mother, gnarls barkley, the killers, the who, mtv virtual world (via lost remote), ...
Datum: 26.09.2006 11:41 •
Größe: 146.5 KB
story links: christopher lydon, dave winer's first payload for rss, lydon's harvard lectures, video of lydon by david tames, podcasting word coined by dannie j. gregoire, podcast ready, podcast and portable media expo (additional events), congratulations to leo laporte of twit, podcast of the year a...
Datum: 25.09.2006 13:35 •
Größe: 146.5 KB
story links: ask joanne - rocketboom411, steven v. asks where does the white go when the snow melts, bill m. asks how is it that teflon sticks to my cooking pans, sue harvey asks why is a sidekick called a sidekick, music
Datum: 22.09.2006 12:01 •
Größe: 146.5 KB
story links: peaceday, chavez calls bush devil, chavez calls bush drunk, donkey, gmail matches ads to email banter, yisrayl hawkins (thanks, leron!), ebay chest ad auction, meet paul abdul auction, jolly rancher auction, rb titanium necklace auction
Datum: 21.09.2006 13:12 •
Größe: 146.5 KB
story links: rb's sherng-lee huang covers the animation block party with scott dodson's super mouse video, gary dirafaelle's boobotz video, teddy hose's tale of lester rhymes
Datum: 20.09.2006 12:48 •
Größe: 146.5 KB
story links: von conference music video with rb field correspondent steve garfield (jeff pulver, jeremy allaire, caroline little, bram cohen, jeff jarvis), dinka music video with rb field correspondent ruud elmendorp, soda pop shop with rb field correspondent zadi diaz
Datum: 19.09.2006 12:48 •
Größe: 146.5 KB
story links: king louis vii the yonnger of france died, chinese footballer li tie born, building pong (thanks, eggzakt!), first woman tourist in space to blog, josh leo cooks soap, musical bottles, make first year book set winner, swiss army mp3 player sucks, no contact jacket, expressions from view...
Datum: 18.09.2006 13:03 •
Größe: 146.5 KB
story links: joanne trains with flynn from the new york jedi lightsaber enthusiasts collective
Datum: 15.09.2006 12:30 •
Größe: 146.5 KB
story links: podcamp2006 interview with joanne by thierry hubert and fredric deriot | extra: interview with podcamp creators chris brogan and chris penn [mov | wmv]
Datum: 14.09.2006 11:49 •
Größe: 146.5 KB
story links: rb field correspondent bre pettis covers david pescovitz interview with ernie fosselius and his handmade automata 3d crank animation (make magazine blogpost, additional images) | thanks: to steve jobs & apple for featuring rocketboom in yesterday's special event: it's show time
Datum: 13.09.2006 11:19 •
Größe: 146.5 KB
story links: rocketboom911, nuclear war to begin today, send in your questions about the world to joanne rocketboom411, make magazine the first year, harvard second life law course, world's largest collection of the world's smallest versions of the world's largest things traveling roadside attractio...
Datum: 12.09.2006 13:06 •
Größe: 146.5 KB
story link: where were you on september 11, 2001?
Datum: 11.09.2006 13:01 •
Größe: 146.5 KB
story link: reggie watts | ongoing: where were you on 9/11?
Datum: 08.09.2006 11:34 •
Größe: 146.5 KB
story links: biggest 3D scaled representation of solar system (via), soon to be biggest 3D scaled representation of solar system, suri consipracy theory, hercules born today with solar eclipse, dorkbot: bre doar's huffyphonic gyrobanshee, jon lippincott's vis virtual universe, david kareve's horrifi...
Datum: 07.09.2006 13:10 •
Größe: 146.5 KB
story links: submit your stories to rocketboom911, interview with von conference creator jeff pulver | extra interview clips: hi-tech c.e.o. poker for charity [mov| wmv], building the von conference [mov|wmv], internet political activism [mov|wmv]
Datum: 06.09.2006 13:10 •
Größe: 146.5 KB
story links: the size of objects in the universe, egyptian mummy coffin from 600 b.c. on ebay, bubble wrap (thanks, donnie c.), antique vintage ouija board on ebay, golf cart game run, picnic '06 crossmedia week conference in amsterdam (video), podcamp unconference in boston (thanks, steve!), video ...
Datum: 05.09.2006 12:57 •
Größe: 146.5 KB
story links: annual tugboat race & competition on the hudson, circus amok, jellynyc pool party
Datum: 04.09.2006 12:54 •
Größe: 146.5 KB
story: central park stare down
Datum: 01.09.2006 12:44 •
Größe: 146.5 KB
story links: 386dx (90's video, 2001 video), fractal recursions (video), rb field correspondent andy carvin finds photography street mob, chuck's blogumentary, magnetic levitation (strawberry, frog), rocket car river jump, light tracer, soap for a mouse, strap-on hat video game controller (via), mo...
Datum: 31.08.2006 12:42 •
Größe: 146.5 KB
story link: interview with blogger steve rubel | extra interview clips: daily routine [mov|wmv], selling-out [mov|wmv], social consciousness [mov|wmv] meetup: meet rb gang joanne, drew, sherng-lee and field correspondent chuck olsen tonight in nyc at the ny video 2.0 group at 7pm or at the pioneer...
Datum: 30.08.2006 13:08 •
Größe: 146.5 KB
story links: katrina devastation video [today], dave winer introduces bbcriver for the blackberry/pda (just like nytimesriver), improv everywhere attacks home depot in slow-motion, ryan patricio makes one-handed speedcubing world record, gooooooooooooooooooooooooooooooooooooooooooooooooooooogle.com ...
Datum: 29.08.2006 12:36 •
Größe: 146.5 KB
story links: rb field correspondent graham walker covers pluto's demotion at the i.a.u. xxvith general assembly, international astronomical union (more conference video)
Datum: 28.08.2006 12:38 •
Größe: 146.5 KB
story links: penciltopia teaches claymation class at the childrens museum of the arts
Datum: 25.08.2006 12:39 •
Größe: 146.5 KB
story links: nasa finds direct proof of dark matter (video), hidden cost of eye accidents may still be higher than expected, cat in wheel, dave winer releases nytimes river for the blackberry and other pdas, internet bench, marshall brown opens more free high-power wi-fi access points in new york ci...
Datum: 24.08.2006 13:54 •
Größe: 146.5 KB
story inks: interview with gary 'numa numa' brolsma, the new numa video, original numa numa
Datum: 23.08.2006 11:58 •
Größe: 146.5 KB
story links: opentopia, d & d billards, earth moon sculpture, safari vet, brandon fuller, small dog electronics
Datum: 22.08.2006 12:40 •
Größe: 146.5 KB
story links: spain beats panama in world basketball championship, rocketboom commentators halt accent change, guitar hero broke my knee dot com, #1 search term by aol users is 'google' (via detnews), ebay voltron camera (via eyebeam) is missed opportunity for jason calacanis, ringtone dancer, oldest...
Datum: 21.08.2006 11:54 •
Größe: 146.5 KB
story links: voice and speech with shane ann, author of all the words on stage
Datum: 18.08.2006 12:20 •
Größe: 146.5 KB
story inks: robert millis of american microphone interviews 1st lt. paul rieckhoff founder of iraq and afghanistan veterans of america, george bush responds to a question about private contractors, audit finds u.s. hid actual cost of iraq projects, contractors in iraq make costs balloon
Datum: 17.08.2006 12:43 •
Größe: 146.5 KB
story links: rb field correspondent ruud elmendorp covers a rare press conference held by joseph kony, leader of the lord's resistance army (l.r.a.)
Datum: 16.08.2006 12:23 •
Größe: 146.5 KB
story links: interactive architecture, history of the yo-yo, field report: 1945 vj day in times square, wire puppet circus, music: sally goodin (adapted) by obed pickard
Datum: 15.08.2006 12:30 •
Größe: 146.5 KB
story links: macbeth becomes king of scotland, u.s. and britain join to defeat hitler, israel and lebanon cease fire, the ballbot (*update: theo says nothing new & cmu sucks), girl takes picture of herself everyday for 3 years, guy takes a picture of himself everyday 12 years for 24 years, girl dres...
Datum: 14.08.2006 13:02 •
Größe: 146.5 KB
story links: we b*girlz breakdancing event at lincoln center [flyer]
Datum: 11.08.2006 12:42 •
Größe: 146.5 KB
story links: takeru kobayashi sets world record at bratwurst eating championships, hot dogs field report on cony island, rocketboom comments, genetically engineered golf-course super grass, joe liberman's website hosted on $15 package (via daily kos), call to the future, aol searcher no. 4417749 com...
Datum: 10.08.2006 13:12 •
Größe: 146.5 KB
story links: two million dollar comma, no warrant needed for tiger or alligator, homemade time fountain, sherng-lee covers dodgeball telephone social networking, water tank nightclub [video] (via
Datum: 09.08.2006 13:17 •
Größe: 146.5 KB
Finden 
Community 
Hilfe 
Produzieren 
MyPodster 
